<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13297
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MAEQQAPKHFYPAPPFFYNHFTQSNLAQLSGVRREHSQTFHDGEAPDSTTLDIPQDLRYLIPPEPPADGKSRAFNAEVGLDIPPQTLADHNIESLVPDTPGTRNNPQRYLISLARSMLTTFLALTGVLSEDPTQYAEKIGDLRMLLYNMHELINQYRPHQARETLIWMMEERVETLRGEIRDIGEAKVKVEGMLRGMAEVGEQQGSDNATAIQGDRGTGAMKEDARREKQRRAWQALQAMESTDDVT |
Length | 247 |
Position | Middle |
Organism | Rachicladosporium antarcticum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Cladosporiales> Cladosporiaceae> Rachicladosporium.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.696 |
Instability index | 52.42 |
Isoelectric point | 5.13 |
Molecular weight | 27887.94 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060
ECO:0000256 ARBA:ARBA00003669
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13297
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.06| 22| 49| 38| 61| 2
---------------------------------------------------------------------------
38- 61 (39.64/27.80) QTF..HDGEA..PDST.TLDIPQdlRYLI
85- 111 (29.42/14.64) QTLadHNIESlvPDTPgTRNNPQ..RYLI
---------------------------------------------------------------------------
|