<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13284
| Description |
Mediator of RNA polymerase II transcription subunit 5 |
| Sequence | MPHAFTDSPSKGWSVALSNALKRHIRPEHLPLRELAARYPTTQLDIADAVILLHDVESYPFVNPLIPKYIEALVLAGSTGISDVLLSLLQHSAFVKHSPSEHEESLASVFPSLEEQVFSLLRVLVIKSKLPASQWRSKATTFTLTRWLHEARKINEREVGKQLSAGLMAAGAGAHTGIFESLCLLVISIFGQPTFREIEKQRWWTSRKQAIAVEMQSYDANVLQWLQSQYTGHLQNLTKNRPFRVIDEKGIPIFADEELLMTIPALRMSHTRAGLFIWLNACLCARPLTDDASMRNHVLVRYSENVQEAAAGLIVASFDVLTNAILGGDSSRVIRSFVCNKLPLLLQGLFSFAKPNASEAAIQSTLSAVNMEPLSPLTAGATGARDVLKKTRADFLQACVMHTLVSDTVASAMSPEPSATTAKATRYTREGLMTQCAHNTARLEAIIMELDGMQGNAGAIAGCLIGIVLNLVTAKDTMTLKSVCNVLLRKIELADVLLQYIQPADLLTPLYRTLDDWVHDEDQSEFQPPYEEFACILLLVLAIHHRYDLTVLEAGAFTADGFVAKVLFGQWQSYTTAELSEQQIAQLSKWIEGLYATDEHGETTGIGDEVMSHCPPQAFYVLVPTLFEQSILACKSGQMSVETARGGQEFLLEPFLLPSLVGGLLWIVKRSWEDHADGDILLQILDKLLRPSSSSQDMQVMHKAILAIVATPLIKSLKILVLQRPDKRKEAESLIAILTPHLHRSRTLASRDPNEASTKGTIDQLRKAVKELVQWATGGGQGTLPTYKSTVIHAATSSSGYDAVLQVIIDELAVQTSAHRGPIALDICTAIVCAPAPSSYTSLLELSNSLVSTPRKTLEIRDMLRVHAANVQALQELPSAEAAALIQLSRAVAAQSAISPSALVSLSVPTAEQAVTDQVMKDLGLTTEGATLDDSLFDPAATFDNDTDFANVNFDVAADATLNLTETQTQDINNLMAADISGMQIDPSTNMFSADSIVFDANQPVLTGNDALMGNSGNVENAEEDIFAGLDFEQETMDFNFD |
| Length | 1042 |
| Position | Tail |
| Organism | Rachicladosporium antarcticum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Cladosporiales> Cladosporiaceae> Rachicladosporium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | 0.049 |
| Instability index | 47.38 |
| Isoelectric point | 5.08 |
| Molecular weight | 113686.62 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13284
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.86| 21| 482| 15| 35| 1
---------------------------------------------------------------------------
15- 35 (36.91/27.68) VALSNALKRHIRPEHL..PL.REL
491- 514 (26.95/17.88) IELADVLLQYIQPADLltPLyRTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.46| 18| 480| 385| 419| 4
---------------------------------------------------------------------------
385- 403 (26.63/41.77) RDVlKKTRADFLQACVMHT
423- 440 (31.83/ 9.99) KAT.RYTREGLMTQCAHNT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.59| 26| 31| 690| 720| 8
---------------------------------------------------------------------------
682- 716 (30.10/32.95) LQILdkllRPSSSSQDmqvmhKAILAIVATPLIKS
717- 745 (38.49/25.97) LKIL.vlqRPDKRKEA.....ESLIAILTPHLHRS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 103.62| 30| 36| 777| 806| 10
---------------------------------------------------------------------------
777- 806 (51.11/29.16) TGGGQGTLPTYKSTVIHAATSSSGYDAVLQ
816- 845 (52.51/30.15) TSAHRGPIALDICTAIVCAPAPSSYTSLLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.27| 22| 523| 66| 87| 11
---------------------------------------------------------------------------
66- 87 (36.76/23.98) IPKYIEALVLAG....STGISDVLLS
587- 612 (34.51/22.06) LSKWIEGLYATDehgeTTGIGDEVMS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.08| 12| 15| 884| 895| 16
---------------------------------------------------------------------------
884- 895 (19.18/13.43) ALIQLSRAVAAQ
902- 913 (19.90/14.26) ALVSLSVPTAEQ
---------------------------------------------------------------------------
|