<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13284

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMPHAFTDSPSKGWSVALSNALKRHIRPEHLPLRELAARYPTTQLDIADAVILLHDVESYPFVNPLIPKYIEALVLAGSTGISDVLLSLLQHSAFVKHSPSEHEESLASVFPSLEEQVFSLLRVLVIKSKLPASQWRSKATTFTLTRWLHEARKINEREVGKQLSAGLMAAGAGAHTGIFESLCLLVISIFGQPTFREIEKQRWWTSRKQAIAVEMQSYDANVLQWLQSQYTGHLQNLTKNRPFRVIDEKGIPIFADEELLMTIPALRMSHTRAGLFIWLNACLCARPLTDDASMRNHVLVRYSENVQEAAAGLIVASFDVLTNAILGGDSSRVIRSFVCNKLPLLLQGLFSFAKPNASEAAIQSTLSAVNMEPLSPLTAGATGARDVLKKTRADFLQACVMHTLVSDTVASAMSPEPSATTAKATRYTREGLMTQCAHNTARLEAIIMELDGMQGNAGAIAGCLIGIVLNLVTAKDTMTLKSVCNVLLRKIELADVLLQYIQPADLLTPLYRTLDDWVHDEDQSEFQPPYEEFACILLLVLAIHHRYDLTVLEAGAFTADGFVAKVLFGQWQSYTTAELSEQQIAQLSKWIEGLYATDEHGETTGIGDEVMSHCPPQAFYVLVPTLFEQSILACKSGQMSVETARGGQEFLLEPFLLPSLVGGLLWIVKRSWEDHADGDILLQILDKLLRPSSSSQDMQVMHKAILAIVATPLIKSLKILVLQRPDKRKEAESLIAILTPHLHRSRTLASRDPNEASTKGTIDQLRKAVKELVQWATGGGQGTLPTYKSTVIHAATSSSGYDAVLQVIIDELAVQTSAHRGPIALDICTAIVCAPAPSSYTSLLELSNSLVSTPRKTLEIRDMLRVHAANVQALQELPSAEAAALIQLSRAVAAQSAISPSALVSLSVPTAEQAVTDQVMKDLGLTTEGATLDDSLFDPAATFDNDTDFANVNFDVAADATLNLTETQTQDINNLMAADISGMQIDPSTNMFSADSIVFDANQPVLTGNDALMGNSGNVENAEEDIFAGLDFEQETMDFNFD
Length1042
PositionTail
OrganismRachicladosporium antarcticum
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Cladosporiales> Cladosporiaceae> Rachicladosporium.
Aromaticity0.06
Grand average of hydropathy0.049
Instability index47.38
Isoelectric point5.08
Molecular weight113686.62
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP13284
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.86|      21|     482|      15|      35|       1
---------------------------------------------------------------------------
   15-   35 (36.91/27.68)	VALSNALKRHIRPEHL..PL.REL
  491-  514 (26.95/17.88)	IELADVLLQYIQPADLltPLyRTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.46|      18|     480|     385|     419|       4
---------------------------------------------------------------------------
  385-  403 (26.63/41.77)	RDVlKKTRADFLQACVMHT
  423-  440 (31.83/ 9.99)	KAT.RYTREGLMTQCAHNT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.59|      26|      31|     690|     720|       8
---------------------------------------------------------------------------
  682-  716 (30.10/32.95)	LQILdkllRPSSSSQDmqvmhKAILAIVATPLIKS
  717-  745 (38.49/25.97)	LKIL.vlqRPDKRKEA.....ESLIAILTPHLHRS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     103.62|      30|      36|     777|     806|      10
---------------------------------------------------------------------------
  777-  806 (51.11/29.16)	TGGGQGTLPTYKSTVIHAATSSSGYDAVLQ
  816-  845 (52.51/30.15)	TSAHRGPIALDICTAIVCAPAPSSYTSLLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.27|      22|     523|      66|      87|      11
---------------------------------------------------------------------------
   66-   87 (36.76/23.98)	IPKYIEALVLAG....STGISDVLLS
  587-  612 (34.51/22.06)	LSKWIEGLYATDehgeTTGIGDEVMS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.08|      12|      15|     884|     895|      16
---------------------------------------------------------------------------
  884-  895 (19.18/13.43)	ALIQLSRAVAAQ
  902-  913 (19.90/14.26)	ALVSLSVPTAEQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP13284 with Med5 domain of Kingdom Fungi
Unable to open file!