<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13277

Description Cell pattern formation-associated protein stuA
SequenceMAPVGQSAPPAGAYQSQSFDTTGQVPPHGMKPRVTATLWEDEGSLCFQVEANGVCVARREDNHFINGTKLLNVAGMTRGRRDGILKSEKTRHVVKIGPMHLKGVWIPFDRALEFANKEKITEHLYPLFVHNIGALLYHPTNQARQQSIGNGAMAARRPESQDYMRTPTGTQPPALTHHHSMGTPVSTGMAQPPHTIAPHPTSGRPGLDRAHTFPTPPTSASGMTMGAGQYDYGNHANAVHPASSSPGSTSHMQYPSSQPYDSRQMYSAPANYSQYPSQHYNSVQPSPGVKSEMAPPTRAGAEHEHAHHKGADGYSGQQDADGEHEGDYTHQSASLGASNASYSAFPNAAPGPIHSEPSHISPEMQNSPQQTGSGRATPRTAAPYSGYSTPQRGSQLPSSNLYNVMSSDTRAGAPNGAEQYPQQGYAPQQYPAMNGVPQNKKRGREADGDDAYGNGLKRARTEGGPQALQRLTDSIATYNPNLTYADQLVTANDAVDRDLELLATHQSNYARIQSLRAQSTALDSSLRSTISQLAQTRKDILAIPPAPSPSSIDQSNELNVDTLLRYAALIAPTTVPPTLRKPIPSIQLPRVKLEGDGSVERVGGLSTPPPQPEGEQGNVKEGIVGIERVGELERGWLAGNGDVGFVPWVSDEAIRGGALAKLEGVSEGNREGKGMEVDQQEDGRVTDEARAEQEEQAGRRTRERARAEVRVFNPDDL
Length717
PositionMiddle
OrganismRachicladosporium antarcticum
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Cladosporiales> Cladosporiaceae> Rachicladosporium.
Aromaticity0.06
Grand average of hydropathy-0.770
Instability index51.72
Isoelectric point6.24
Molecular weight77101.07
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
DNA binding	GO:0003677	IEA:UniProtKB-KW
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
conidium formation	GO:0048315	IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro
sporulation resulting in formation of a cellular spore	GO:0030435	IEA:UniProtKB-KW









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP13277
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.43|      14|      18|     434|     451|       2
---------------------------------------------------------------------------
  434-  451 (20.27/19.22)	NGVpqnkKRGREADGDDA
  454-  467 (26.16/13.18)	NGL....KRARTEGGPQA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.29|      23|      26|     241|     265|       3
---------------------------------------------------------------------------
  241-  263 (44.45/19.57)	PASSSPGSTS.HMQYPSSQPYDSR
  352-  375 (27.84/ 6.91)	PIHSEPSHISpEMQNSPQQTGSGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.43|      21|      25|     582|     605|       4
---------------------------------------------------------------------------
  582-  603 (34.55/19.55)	PIPSIQLPRVKlEGDGSVERVG
  610-  630 (36.88/18.90)	PQPEGEQGNVK.EGIVGIERVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.94|      15|      15|     678|     692|       5
---------------------------------------------------------------------------
  678-  692 (25.70/13.43)	DQQEDGRVTDEARAE
  694-  708 (25.24/13.08)	EEQAGRRTRERARAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.75|      25|      27|     475|     499|       7
---------------------------------------------------------------------------
  475-  499 (41.69/31.70)	IATYNPNLTYADQLVTANDAVDRDL
  502-  526 (40.06/30.13)	LATHQSNYARIQSLRAQSTALDSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     102.78|      24|      27|     298|     322|       8
---------------------------------------------------------------------------
  298-  321 (43.21/19.56)	RAGAEHEHAHHKGAD..GYSG.QQDAD
  324-  350 (28.38/10.72)	HEGDYTHQSASLGASnaSYSAfPNAAP
  410-  429 (31.18/10.92)	RAGAPNG.AEQYPQQ..GYAP.QQ...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.87|      10|      27|     543|     552|       9
---------------------------------------------------------------------------
  543-  552 (18.87/10.17)	IPPAPSPSSI
  570-  579 (18.00/ 9.28)	IAPTTVPPTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.56|      12|      27|     631|     644|      10
---------------------------------------------------------------------------
  631-  644 (15.07/14.37)	ELErGWLAGNGDvG
  661-  672 (20.48/ 9.20)	KLE.GVSEGNRE.G
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP13277 with Med4 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LAKLEGVSEGNREGKGMEVDQQEDGRVTDEARAEQEEQAGRRTRERARAEVRVFN
2) PTNQARQQSIGNGAMAARRPESQDYMRTPTGTQPPALTHHHSMGTPVSTGMAQPPHTIAPHPTSGRPGLDRAHTFPTPPTSASGMTMGAGQYDYGNHANAVHPASSSPGSTSHMQYPSSQPYDSRQMYSAPANYSQYPSQHYNSVQPSPGVKSEMAPPTRAGAEHEHAHHKGADGYSGQQDADGEHEGDYTHQSASLGASNASYSAFPNAAPGPIHSEPSHISPEMQNSPQQTGSGRATPRTAAPYSGYSTPQRGSQLPSSNLYNVMSSDTRAGAPNGAEQYPQQGYAPQQYPAMNGVPQNKKRGREADGDDAYGNGLKRARTEGGPQALQRLTDSIA
659
139
713
476










Molecular Recognition Features






MoRF SequenceStartStop




NANANA