<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13274

Description Mediator of RNA polymerase II transcription subunit 17
SequenceMADSFTLPLRPIPEKRDRPDTLPVEIAQINNQWGSFREVNEDVLRNKIAEEEEKDGLEEVEESDQDATDLDSTERLEQLYKRRAEITQFAMQAHMETMFALDFVSLLLSKQAPRQAETSMSAFLKQVAPLGSLNAEVVHSPSKPESTTKDVSAVSRGWRIQNFNAAANKLLQAASRLETEVASETRYWNEVLAVKDKGWKVSRLPLERQSLGVQYGFLEATPVFRDRGLASLRRAEDGALSLDEGLIPPKARFVRVRVIQDGRLSGSSKPMRSSFNGDGTIEDRILQARDTVYEYELFHELVREARAIASFGVTTRQNLIQIPASDNLEILLDLVDTDEDTSEPEHGISQQGTSIAEGLAHTIRILLAYAHRQNLRRRTQLPLPLTPKTRPVPEHQLIRPALAYIKHMSQVRWLQSLLEDLFGVLQSAGLKPPAYTARIFSTGMQSHNSPTPAVENLVGQFLTPLLSTFNGNILTPRASFSIAIHTNLSSPPFGTTFEVSFNMPKYPDLESPGKLSHKEEVEAAITHLLLLDVVFTISSNSSLKPECDKDQAKRTWEAIYPQHGELLIPTPKPNSEKRKKMKVVLSRHELSLEIYTVRCIDGTGRGNWEMPSYHSMPHTWKPSPIAGPPNRPSLMDFVSSEVSRS
Length645
PositionHead
OrganismPenicillium nalgiovense
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
Aromaticity0.07
Grand average of hydropathy-0.439
Instability index53.12
Isoelectric point6.04
Molecular weight72393.23
Publications
PubMed=28368369

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP13274
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.36|      16|      19|      25|      41|       1
---------------------------------------------------------------------------
   25-   41 (24.89/19.63)	EIAQINNQWGsFREVNE
   47-   62 (25.47/15.02)	KIAEEEEKDG.LEEVEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     150.99|      52|     178|     227|     287|       2
---------------------------------------------------------------------------
  227-  286 (76.85/76.27)	RGLASLrrAED..GALSlDEGLIPP..KArfvrvRVIQDGRLS.GSSKPMRSSFNGD......GTIEDRIL
  412-  474 (74.14/46.34)	RWLQSL..LEDlfGVLQ.SAGLKPPayTA.....RIFSTGMQShNSPTPAVENLVGQfltpllSTFNGNIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     116.13|      35|     176|     309|     344|       3
---------------------------------------------------------------------------
  309-  344 (53.47/38.14)	ASFGVTTRQNLIQIPASDNLEILLDLvDTDEDTSEP
  478-  512 (62.66/40.66)	ASFSIAIHTNLSSPPFGTTFEVSFNM.PKYPDLESP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.27|      13|     378|       7|      19|       4
---------------------------------------------------------------------------
    7-   19 (27.46/15.27)	LPL....RPIPEKRD.RP
  383-  400 (17.81/ 7.46)	LPLtpktRPVPEHQLiRP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.50|      11|      38|     150|     160|       5
---------------------------------------------------------------------------
  150-  160 (20.77/13.69)	DVSAV.SRGWRI
  190-  201 (15.73/ 8.81)	EVLAVkDKGWKV
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP13274 with Med17 domain of Kingdom Fungi
Unable to open file!