| Description | Uncharacterized protein |
| Sequence | MDPTTPSDWPPSDWPPSDLSSSSDDNKKNAPSMDSRPTAKELLDRVDYDISQLLQRFENIIAIAAKKFDGTSHVDAAVEAFQIDVESTALIRAAEDLLALHRLMKELWLFGKLDTLGEDERDIQRREKLEEDVKAIQKALDGGLLMPSSDGPQKLEKSEDIEKHPAVPEA |
| Length | 170 |
| Position | Head |
| Organism | Penicillium nalgiovense |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.648 |
| Instability index | 54.23 |
| Isoelectric point | 4.53 |
| Molecular weight | 18965.99 |
| Publications | PubMed=28368369 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP13271 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) DWPPSDW 2) EDIEKHPAVPEA | 8 159 | 14 170 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab