Description | Uncharacterized protein |
Sequence | MDPTTPSDWPPSDWPPSDLSSSSDDNKKNAPSMDSRPTAKELLDRVDYDISQLLQRFENIIAIAAKKFDGTSHVDAAVEAFQIDVESTALIRAAEDLLALHRLMKELWLFGKLDTLGEDERDIQRREKLEEDVKAIQKALDGGLLMPSSDGPQKLEKSEDIEKHPAVPEA |
Length | 170 |
Position | Head |
Organism | Penicillium nalgiovense |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.648 |
Instability index | 54.23 |
Isoelectric point | 4.53 |
Molecular weight | 18965.99 |
Publications | PubMed=28368369 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13271 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) DWPPSDW 2) EDIEKHPAVPEA | 8 159 | 14 170 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab