<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13263
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MADTNQQRAVTAAFASLPPLWEHFTRENLDRLEQIKTEASTDKNDLPPELRFLVPPETPTGQYSMFEQGIEQLYPDPVTDPEQDTPKPSPPLNHAYYFLKISKSLLLNFLEFVGILSVSPEQFESKVEDMRNLFINAHHFLNLYRPHQARESLIMMLEEQLARSKEEINRMEMFKADIEITLNQLEAEGKQIGSAAQTEGVC |
| Length | 202 |
| Position | Middle |
| Organism | Penicillium nalgiovense |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.511 |
| Instability index | 42.64 |
| Isoelectric point | 4.75 |
| Molecular weight | 23193.98 |
| Publications | PubMed=28368369
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060
ECO:0000256 ARBA:ARBA00003669
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13263
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.43| 21| 29| 103| 125| 2
---------------------------------------------------------------------------
103- 125 (30.53/26.60) KSLLLNFLEFVGIlsVSPEQ.FES
131- 152 (34.90/23.54) RNLFINAHHFLNL..YRPHQaRES
---------------------------------------------------------------------------
|