<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13258
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNAPTTPPPNVPDAAPALAKIIKNKSSPPVPASIANTAGGAAAVAGNASPPLAPPQQPGAAPATAPENQDPGLPPAPDSPRTFASRQRELARDLIIKEQQIEHLISVLPGIGASEAEQEARIRELETELRGVEKERAAKVRELKRLRTRLEDVLGAVAVGIHRDEYPQK |
| Length | 199 |
| Position | Middle |
| Organism | Penicillium nalgiovense |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.417 |
| Instability index | 60.07 |
| Isoelectric point | 5.68 |
| Molecular weight | 21223.77 |
| Publications | PubMed=28368369
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13258
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.18| 20| 20| 69| 88| 1
---------------------------------------------------------------------------
46- 68 (24.66/ 9.35) PALAKIIK.NKSSPPVPasiANTA
69- 88 (37.62/18.04) GGAAAVAG.NASPPLAP...PQQP
89- 110 (29.90/12.87) GAAPATAPeNQDPGLPP..aPDSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.91| 13| 15| 147| 160| 2
---------------------------------------------------------------------------
147- 160 (17.34/12.12) EQEARIRELEtELR
165- 177 (19.58/ 9.59) ERAAKVRELK.RLR
---------------------------------------------------------------------------
|