<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13257

Description Uncharacterized protein
SequenceMIPHSSAGGQPWGHPLRTFNGGPGRVDNAQMLGQYDQPDRPVSLPQPPIRQPVVDLTAGGPESQDREPPSKRLRLDVPSGTNTSDTGAGVGETRSTPGSAISRPAVSWRGRPVWSFQAVVSETPSSENRSDGAGPKPPSPPPLPTQPWMNNFVAEPEASAVVRSRESSPVGTVQTTPYRIEIPSVAPVYKDHKPADFTPWTGNHPEDVLSEQTAKQGYYDRTQVSQNESNTARPALYAQLKNRTGLQMLSSVFAAALEKRQSHNTIHAPSTFKPPPRVTLTDNKREAWLRDLANPSVPLRRLSRTIPHGIRGKILLDQCLGKWIPVARAVWLAKCVGANEIRAFKRKGTSGALAVGLEAKWVREWTTNVQQFVEGVFAAPKSSDWKAKMTYAVGLTARLFSENLLDHEHFLEWFLSSFEAASIGSIPIWLLMLGIYWNSIMRYRRRGRRLAELLLQKVRQATELKLTQLQPLIDRLSRFIKKLVLNHTSSMILPTCWETYKLQVSSALDLDNEAEKALFQSLAERNARVQRPRHSKQTTQRSPHQRIVQLLDSIRSAQDLSSTFSYLDAFDDKAILVSKLLEWLSTPFRHGLWRVYIGVRLLRKWKLSGIDIDSHILAFLSRGQNNQKLKMDQIYHVVSELVRSQTFSVGRYLQWLMARGVTNGSNSAAERKAKDLPIDIGLIAQLPVSRLPEHVGNLRSTLLTRTGLSSLEENAAIDSAKDTISQRLPGIFGVNDSASMALDSLPPDLPWAVKAEVGQWLRGAIAEHTRSAESTNRGANPVGIAPVVSALTPAEFYTVRDALESFGDISMLADVLKFASSCGDSTVLASVADTTNCHFDSLCVIGATTDLFRRLIDAYAAIKRVGIPSLDLIFSLIELGLRIPSELNTVSILRQDLSRMENRSIMAASSPVSDHIVDGFGGDDPLFREKLDRLLQSGNVMDEPTLDAIFNTLIKHLESDDGHANLSANDTCRYLAQLRSFHPKHFDGILARWVCGHLRSPERTILLRILPPLIGVGCVTIRAFLALAKRLTLSTPATVPNAAQLSADLVQLLVPGDEDSKSFDLVSYRFQLAQQEFLNKNSEEALKIVCDAASSRAGVSLAGHSELERSIVMLLRDLLVRHPECAARNGMQKLIDQHPAALSIFQKALDLLLGVESQSDGNSVLSKVEKLARMTDDFSLPFCQLKLQVLFHADSESEDRNNIVDAMFKTAVSDCRAQRLHWVDLVALMSPDAVRQIRERAEKEFFSIPLLEEPIGDISDSPDKLGSLKTAKMYLTIIEELASSIPDSGAPSIAPVLVEKMDSLLHKIITMHNSTLAKGVANTDRSEFERAHAFWFSALLRIIVLHRSAFAQPPPALKINPLHEQLRLLTSIFCIALSRLPGDVLRLFPAADYFPHPPPAEGFRPCPGILLQTHALDVAASLIDIFPDEVRHQCARFLKEKCPSFVPFQNDSRFLYLLGPMTDHYPANAQQVSAPSPAASGSTPAPTPGLFSIAGSSPAQQSVPSASGLSTAPADSNCIANRLRLQHRGRVVGPYPVRPWELLEDAAPFLGVNDTAVNLGFFDARRVRA
Length1569
PositionKinase
OrganismPenicillium nalgiovense
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
Aromaticity0.07
Grand average of hydropathy-0.189
Instability index49.50
Isoelectric point8.65
Molecular weight173058.80
Publications
PubMed=28368369

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP13257
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     107.30|      37|      71|     660|     701|       1
---------------------------------------------------------------------------
  656-  692 (62.64/38.84)	LMAR.....GVTNGSNSAAERKAKD.....LPIDIGL..IAQLPVSRLP
  698-  746 (44.66/17.63)	LRSTlltrtGLSSLEENAAIDSAKDtisqrLPGIFGVndSASMALDSLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.57|      16|      37|    1303|    1318|       2
---------------------------------------------------------------------------
 1303- 1318 (27.89/16.05)	SLLHKIITMHNSTLAK
 1337- 1352 (26.68/15.07)	SALLRIIVLHRSAFAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     121.66|      37|      41|     344|     383|       3
---------------------------------------------------------------------------
  344-  383 (61.26/49.17)	FKRKGTsgaLAVGLEAKWVREWTTNVQQFVEGVF....AAPKSS
  385-  425 (60.40/40.11)	WKAKMT...YAVGLTARLFSENLLDHEHFLEWFLssfeAASIGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     155.55|      37|      42|      87|     126|       4
---------------------------------------------------------------------------
   43-   80 (34.10/11.64)	........SLPQPPIRQPVVDLtaggpesqdREPPSKRLR..LDV...PSG
   87-  126 (61.66/33.60)	GAGVGetrSTPGSAISRPAVSW.........RGRPVWSFQ..AVVSETPSS
  130-  168 (59.79/27.07)	SDGAG...PKPPSPPPLPTQPW.........MNNFVAEPEasAVVRSRESS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.42|      19|      37|    1142|    1160|       5
---------------------------------------------------------------------------
 1142- 1160 (30.05/15.66)	LSIFQKALDLLLGVESQSD
 1180- 1198 (33.38/18.11)	LPFCQLKLQVLFHADSESE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     185.67|      38|      38|     922|     959|       6
---------------------------------------------------------------------------
  851-  878 (28.44/13.38)	....LFRRLIDAYAAIKRV.GIPSLDLIF.SLI.E....
  884-  918 (40.23/22.29)	...PSELNTVSILRQDLSRMENRSIMAASSPVS.DHIVD
  922-  959 (60.92/37.94)	GDDPLFREKLDRLLQSGNVMDEPTLDAIFNTLI.KHLES
  962- 1000 (56.09/34.28)	GHANLSANDTCRYLAQLRSFHPKHFDGILARWVcGHLRS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     118.73|      38|     280|     203|     243|       7
---------------------------------------------------------------------------
  203-  243 (56.80/44.71)	NHPEDVLsEQTAKQGYydRTQVSQ..NESNTARPALYAQLKNR
  486-  525 (61.93/37.33)	NHTSSMI.LPTCWETY..KLQVSSalDLDNEAEKALFQSLAER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      98.50|      30|    1106|     246|     276|       9
---------------------------------------------------------------------------
  246-  276 (51.50/33.15)	LQMLSSVFAAALeKRQSHNTIH...APSTF.KPPP
 1366- 1399 (47.00/25.71)	LRLLTSIFCIAL.SRLPGDVLRlfpAADYFpHPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.74|      20|      28|    1230|    1253|      10
---------------------------------------------------------------------------
 1230- 1253 (24.09/26.74)	SPDAVRQIreRAEKEFFSIplLEE
 1261- 1280 (33.65/20.38)	SPDKLGSL..KTAKMYLTI..IEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.74|      12|     465|     818|     832|      11
---------------------------------------------------------------------------
  805-  816 (21.42/15.58)	SFGDISMLADVL
  821-  832 (21.31/ 8.67)	SCGDSTVLASVA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP13257 with Med12 domain of Kingdom Fungi
Unable to open file!