Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MLNMADSQQRAVTAAFAPPPPLWKHFTQDNLNRLEEIKKEASKGPNGEPVRDKKWSPSELRALDIPPELRFLVPPEIPTGEYSVFGELQTLSTTLPSLQEQGIDQLYPGPTETNEQDNTQGPPQLNHAYYLLKISKSLLLNFLEFVGALSVSPEQFESKVNDLRNLFINAHHLLNLYRPHQARESLIMMMEEQLQRSKDEIDQMDKVKAEIESALEQMQAQAGETKPEEPPAEKVSAPKEDSRGAEDARHMWDILDKEI |
Length | 259 |
Position | Middle |
Organism | Penicillium steckii |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.711 |
Instability index | 53.72 |
Isoelectric point | 4.84 |
Molecular weight | 29419.83 |
Publications | PubMed=28368369 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13252 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 89.94| 26| 179| 34| 59| 1 --------------------------------------------------------------------------- 34- 59 (45.52/25.07) LEEIKKEASKGPNGEPVRDKKWSPSE 215- 240 (44.42/24.32) LEQMQAQAGETKPEEPPAEKVSAPKE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AEKVSAPKEDSRGAEDARHMWDILDKEI 2) FTQDNLNRLEEI | 232 26 | 259 37 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab