<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13248
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLSTYHDNSPAIPPPNVPDAVPALAKMSKNTTSPPIPASVAASADASGAGPAASPPPPQPQQPGAAPGTAEIQDPNQPPEPDSPSTFASRQRELARDLIIKEQQIEYLISVLPGIGTSEAEQEAKIRELEVQLREVEEKREAKALELKKLRGKLENVLGAVSVGIYGDKEYQNGTVSA |
| Length | 202 |
| Position | Middle |
| Organism | Penicillium steckii |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.439 |
| Instability index | 57.70 |
| Isoelectric point | 4.68 |
| Molecular weight | 21463.85 |
| Publications | PubMed=28368369
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13248
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 86.99| 18| 18| 70| 87| 1
---------------------------------------------------------------------------
49- 66 (25.55/ 8.66) AKMSKNTTSP.PIPASVAA
70- 87 (34.95/14.20) ASGAGPAASP.PPPQPQQP
90- 108 (26.49/ 9.21) APGTAEIQDPnQPPEPDSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.92| 28| 47| 115| 150| 2
---------------------------------------------------------------------------
115- 143 (42.90/36.35) QRElARDLIIKE..QQIEYLI.SVLPGI.GTSE
163- 194 (31.02/11.43) KRE.AKALELKKlrGKLENVLgAVSVGIyGDKE
---------------------------------------------------------------------------
|