<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13235
| Description |
Uncharacterized protein |
| Sequence | MSLTNPPSSGPLSVRRTVGQSLKRSAVDEPYDASRGLSGSSGYTSKVRVRDRYHIVGFISSGTYGRVYKAIGKNGRKGEFAIKKFKPDKEGETIQYTGLSQSAIREMALCTELNHANVIQLEEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHPIAARMVRSILFQLLNGLLYLHTNWVLHRDLKPANILVTSGGAIRVGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLLGSRHYTPAVDMWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIVEILGPPRKETWPGLVSMPEYTQLQSMVLHRQPPHYHRGPNLEGWYQNCLKNAGYSSSSSTGTPGTDGFNLLSRMLEYDPTKRITAQEALEHPYFTNGGPISGNCFDGIESKYPHRRVTQDDNDIRTGSLPGTKRSGLPDDSLMRASKRLRE |
| Length | 439 |
| Position | Kinase |
| Organism | Penicillium steckii |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.428 |
| Instability index | 41.85 |
| Isoelectric point | 9.40 |
| Molecular weight | 49418.02 |
| Publications | PubMed=28368369
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13235
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 97.43| 21| 168| 136| 156| 6
---------------------------------------------------------------------------
136- 156 (38.85/20.33) EYTEHDLLQIIHHHTQPQRH..P
279- 298 (26.92/12.32) .FQRNQMMKIVEILGPPRKE..T
307- 327 (31.65/15.50) EYTQ..LQSMVLHRQPPHYHrgP
---------------------------------------------------------------------------
|