<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13214
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRTHPTSFQARPPSPSSPAGSLKENHRLPISSEHIPQTPTSPPLMSVNEQSHAANFTSSHTSPNQATVQPPNISSPPSSAPMSTQVSQQPTMSTTNSFPTPASSVSGHPANATSEDVDQGRKSFNMGIQDSAENSGAAPAQQQTQQPTQHRPTDHDRQSLQTESTNDFATGQGQHSTDPDAMDVDTEPTRRADTLSLDLDSLQKELTSAFHLCKSSPIVTGPDPSVDLVSLYGLGSIAHSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPHKQEIGAPGSLRYMTLWPEEEWQNQKVHGKAIKVSDMDSALQNLQSRAMQMEPGPIPNNDWWEDILGHEKQAKNPAPGETGKKAAPAPAAGRPSMQSYAASPRSQEAERPRPSRGRKRNYDDNSFAGYGEGFVDDDDDPGFYSNGEGTGKKKRKKDHVAKVSTPMSERSASYGVGMFGIGAR |
| Length | 458 |
| Position | Head |
| Organism | Penicillium solitum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.958 |
| Instability index | 57.61 |
| Isoelectric point | 6.44 |
| Molecular weight | 49391.68 |
| Publications | PubMed=28368369
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13214
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 108.17| 26| 27| 14| 39| 1
---------------------------------------------------------------------------
14- 39 (50.47/31.39) PPSPSSPA.GSLKE.NHRLPISSEHI.P.Q
41- 67 (21.05/ 7.90) ...PTSPPlMSVNEqSHAANFTSSHTsPnQ
72- 90 (36.65/20.36) PPNISSPP.SS.......APMSTQ.V.S.Q
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.03| 13| 15| 395| 407| 2
---------------------------------------------------------------------------
395- 407 (26.21/14.57) NYDDNSFAGYGEG
411- 423 (26.82/15.06) DDDDPGFYSNGEG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 81.08| 18| 21| 155| 172| 3
---------------------------------------------------------------------------
155- 172 (31.95/23.22) TDHDRQSLQTESTNDFAT
179- 196 (30.34/21.64) TDPDAMDVDTEPTRRADT
197- 212 (18.78/10.29) LSLDLDSLQKELTSAF..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.06| 17| 21| 352| 368| 4
---------------------------------------------------------------------------
352- 368 (29.55/16.36) APGETGKKAAPAPAAGR
376- 392 (30.51/17.16) ASPRSQEAERPRPSRGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.56| 19| 19| 263| 281| 5
---------------------------------------------------------------------------
263- 281 (31.80/19.08) GKLKGLGLAGRNKPHKQEI
285- 303 (35.76/22.28) GSLRYMTLWPEEEWQNQKV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.21| 20| 27| 104| 123| 6
---------------------------------------------------------------------------
104- 123 (33.28/17.57) ASSVSGHPANATSEDVDQGR
134- 153 (34.93/18.81) AENSGAAPAQQQTQQPTQHR
---------------------------------------------------------------------------
|