Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDRTHPTSFQARPPSPSSPAGSLKENHRLPISSEHIPQTPTSPPLMSVNEQSHAANFTSSHTSPNQATVQPPNISSPPSSAPMSTQVSQQPTMSTTNSFPTPASSVSGHPANATSEDVDQGRKSFNMGIQDSAENSGAAPAQQQTQQPTQHRPTDHDRQSLQTESTNDFATGQGQHSTDPDAMDVDTEPTRRADTLSLDLDSLQKELTSAFHLCKSSPIVTGPDPSVDLVSLYGLGSIAHSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPHKQEIGAPGSLRYMTLWPEEEWQNQKVHGKAIKVSDMDSALQNLQSRAMQMEPGPIPNNDWWEDILGHEKQAKNPAPGETGKKAAPAPAAGRPSMQSYAASPRSQEAERPRPSRGRKRNYDDNSFAGYGEGFVDDDDDPGFYSNGEGTGKKKRKKDHVAKVSTPMSERSASYGVGMFGIGAR |
Length | 458 |
Position | Head |
Organism | Penicillium solitum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.958 |
Instability index | 57.61 |
Isoelectric point | 6.44 |
Molecular weight | 49391.68 |
Publications | PubMed=28368369 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13214 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 108.17| 26| 27| 14| 39| 1 --------------------------------------------------------------------------- 14- 39 (50.47/31.39) PPSPSSPA.GSLKE.NHRLPISSEHI.P.Q 41- 67 (21.05/ 7.90) ...PTSPPlMSVNEqSHAANFTSSHTsPnQ 72- 90 (36.65/20.36) PPNISSPP.SS.......APMSTQ.V.S.Q --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.03| 13| 15| 395| 407| 2 --------------------------------------------------------------------------- 395- 407 (26.21/14.57) NYDDNSFAGYGEG 411- 423 (26.82/15.06) DDDDPGFYSNGEG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 81.08| 18| 21| 155| 172| 3 --------------------------------------------------------------------------- 155- 172 (31.95/23.22) TDHDRQSLQTESTNDFAT 179- 196 (30.34/21.64) TDPDAMDVDTEPTRRADT 197- 212 (18.78/10.29) LSLDLDSLQKELTSAF.. --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 60.06| 17| 21| 352| 368| 4 --------------------------------------------------------------------------- 352- 368 (29.55/16.36) APGETGKKAAPAPAAGR 376- 392 (30.51/17.16) ASPRSQEAERPRPSRGR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 67.56| 19| 19| 263| 281| 5 --------------------------------------------------------------------------- 263- 281 (31.80/19.08) GKLKGLGLAGRNKPHKQEI 285- 303 (35.76/22.28) GSLRYMTLWPEEEWQNQKV --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 68.21| 20| 27| 104| 123| 6 --------------------------------------------------------------------------- 104- 123 (33.28/17.57) ASSVSGHPANATSEDVDQGR 134- 153 (34.93/18.81) AENSGAAPAQQQTQQPTQHR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DDPGFY 2) DWWEDILGHE 3) GEGFV 4) KKKRKKDHVAKVST | 413 336 405 426 | 418 345 409 439 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab