<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13213
Description |
Uncharacterized protein |
Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNAPTIPPPNVPDAVPALAKMTKNSSSPPVPAAIANRVGGAATVAGNASPPLAPPQQPGAAPAAAAEGGDPNLPPAPDSPSTFASRQRELARDLIIKEQQIEYLISVLPGIGASEAEQEARIRELETELRDVEKERAAKVRELKKLRNRLDDVLGAVAVGIHGDGYPPK |
Length | 199 |
Position | Middle |
Organism | Penicillium vulpinum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.316 |
Instability index | 59.03 |
Isoelectric point | 5.11 |
Molecular weight | 20982.50 |
Publications | PubMed=28368369
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP13213
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 107.24| 18| 20| 71| 88| 1
---------------------------------------------------------------------------
27- 42 (23.70/ 6.84) ..TTYHDNAPTIPP.PNVP
48- 65 (24.71/ 7.37) LAKMTKNSSSPPVP.AAIA
71- 88 (31.70/11.04) AATVAGNASPPLAP.PQQP
92- 110 (27.13/ 8.64) PAAAAEGGDPNLPPaPDSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.38| 14| 15| 147| 161| 2
---------------------------------------------------------------------------
147- 161 (19.32/21.16) EQEARIRELEtELRD
165- 178 (23.05/18.59) ERAAKVRELK.KLRN
---------------------------------------------------------------------------
|