<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13190
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MPLMMDAGINVDDLFGESNSLELGLPAASPTKGLAQCLDEMRLLGCCHKIAWSRMGCIASISQDGLRVNIRHLQCSTLEGKWNLGKETPLTTSIEAHHGNQLAHLSWNETGSELAVVDCSGRISIYSISIALNSLSILRQASFESGDDNSQVVGLMWLNSQRFIHAFHQAAKVNGRWAYTPFRRRPIGPFHPANKGALICVTRAGQIKLIYQNPNSTWAELPAELKNTGYSDRLLTHASMVATQAGILLATYSACQKMCLYRVHIAWNPPQWEPTQGKQQPPPVPSFRLNHCKVDMPGNILNVNRGPEHADQSIPFMNSVYSLTRLEIMPAQSDSPQGSTANPWILAVFSKPLHAIPDYQEQQGPPTVMLRWHLESTPQTLHPKFDEVASKKSNTQVKPKLELRRLDDIHCDKYVVSVDLIEHGTVLAVTHDDSSITCYDTRTMTIFSGMDDSNTVTCLAQAGFQYPVEPSGLHLAFSPNSCVAVTLDSDGNMQLRVMVHSFGSTDGLYDETKFSAAVAALTVAFCRGCGSECNTDDVLMVALRQLSPEAQTTFISEVYRALPVNCNFTADQEKLMSHPYIPRCLSLQAALGYKGRLKRRNLTSSVPWAILQLRHSSVLFAYFFQYNKGVQPETHDPDVLRLVLGNAKWTLDFSHWLLNEIFDMADDFESVFNDQEAFTQKLKTSSSLPLLILLSSMSRAFLRFICRGLRGVHAGFATANPASLFGDSRIYFTEICQTIETSPVRIDVYEKFLAGVDSAVKHAYQGAGFGDAERPGPEKELLVNARIPPVLISAVATLLRQTVPALKMEINRMAIYLGDYSWLGFGNDSRTALYRKQRDVDILKKCPLRPPLLLGSDGRVAPLKKRRCARCCEVSGDTSLPRSMLSFKMTAKLGLLRSCLCGGMWILEVDSGDAGGSGSGSGNGSGHGHGHGHGA |
| Length | 935 |
| Position | Tail |
| Organism | Penicillium antarcticum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.156 |
| Instability index | 44.30 |
| Isoelectric point | 7.53 |
| Molecular weight | 102964.67 |
| Publications | PubMed=28368369
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13190
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 94.72| 18| 80| 274| 291| 5
---------------------------------------------------------------------------
274- 291 (35.07/23.17) PTQGKQQPPPVPS.FRLNH
307- 325 (26.04/15.11) PEHADQSIPFMNSvYSLTR
357- 373 (33.61/21.86) PDYQEQQGPPTVM.LRW.H
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 116.59| 32| 552| 207| 267| 6
---------------------------------------------------------------------------
174- 205 (61.28/42.57) NGRWAYTPFRRRPIGPFHPANKGALICVTRAG
215- 246 (55.32/55.24) NSTWAELPAELKNTGYSDRLLTHASMVATQAG
---------------------------------------------------------------------------
|