Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSTNDMTEISSEHTRTDHDRQSFSKHADTTAQDQQKSDLDAMEVDTEPARRPDISNLGLDSLQKELTSAFHLCKSSPIVTGPDPSVDLVSLYGLGPIAHSVARLDPVTGEKINRLRKSYEGKLKGLGLAGRNKSIKQEPGAPGSLRHMTLWPEEEWQNQKVFGKQIKISDIDTALQDLQSRAMQMEPGPVPNNDFWEDILGHEKPVKHPAPNEHSKKAASTPSGRPSMQSYATSPPPQSQEAERPRPSRGRKRHYDDNSFAGYGEGFVDDEEDPGFYSNGEGTGKKKRKKDHVAKVSTPMSSGGSYGVGMFDVYTVPNYNMQ |
Length | 322 |
Position | Head |
Organism | Penicillium antarcticum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.972 |
Instability index | 50.70 |
Isoelectric point | 6.14 |
Molecular weight | 35591.03 |
Publications | PubMed=28368369 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13188 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 314.77| 97| 140| 23| 126| 1 --------------------------------------------------------------------------- 23- 126 (152.05/116.29) FSKHA.....DTTAQDQQKSdldAMEVDTEPARRPDI..SNLGLDSLQKELTSAFHLCKSSPIVTGPdPSvdlVSLYGLGPIAHS..VARLDPVTGEKINRLRKSYEGKLKGL 162- 267 (162.71/104.70) FGKQIkisdiDTALQDLQSR...AMQMEPGPVPNNDFweDILGHEKPVKHPAPNEHSKKAASTPSGR.PS...MQSYATSPPPQSqeAERPRPSRGRKRHYDDNSFAGYGEGF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FWEDIL 2) KKRKKDHVAKVSTP 3) YTVPNYNM | 195 286 314 | 200 299 321 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab