Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MATQGAPMEEIMWRSPPHVQMMGGFLHSNNILFYFAESPFFDATSNNASLAIQANYNEAFRHFVETREAFEGRLKTMQGLEFVVHYDPLQAAAQTNTSFAHEPSNIWVIRKQNRRKRSGFEDEVSVISTFFVVGEAIYMAPSVASVVGNRILSAVTSLSRFMKTASTVPTFTPSYGHTYMPPGVRSKEPNQQSSQQSKESTPMPDAPSDSQSTSKSNLGVSASSSNYQDTRSLAESFNLLTRYGDEFMDENPLAGEPGSFILSRTGGDGGASKQAAPKPAGASLTVPAAGPPARATTPQVRVETPKSSDKGASPPSSGGDRGKRKKSRNVV |
Length | 331 |
Position | Head |
Organism | Penicillium antarcticum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.518 |
Instability index | 62.60 |
Isoelectric point | 9.00 |
Molecular weight | 35774.45 |
Publications | PubMed=28368369 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13187 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 160.53| 49| 65| 140| 189| 1 --------------------------------------------------------------------------- 141- 189 (83.97/51.63) PSVASVVGNRILSAVTSLSRFMKTASTVPTFT..PSYGHTYMPPGVRSKEP 207- 257 (76.56/50.51) PSDSQSTSKSNLGVSASSSNYQDTRSLAESFNllTRYGDEFMDENPLAGEP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KGASPPSSGGDRGKRKKS 2) LTVPAAGPPARATTPQV | 310 284 | 327 300 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab