Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MSDKAPPEPEDFTYLDRIQQLNEVDKDVTKLIHSAGLAIQALTSSKPVPTDSCPAADGSLDSHKARFKEATSQYFSLLSSIDVRLRRQVYALDDAGALGGDSDSGKSTRTDSSTGTSSSANPMDVSRLNSRKDPTAMDKEAEIWAAAREFVDGISLPHCQDKVNDSEKMQED |
Length | 172 |
Position | Head |
Organism | Penicillium antarcticum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.697 |
Instability index | 46.51 |
Isoelectric point | 4.73 |
Molecular weight | 18668.30 |
Publications | PubMed=28368369 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13179 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 115.10| 35| 40| 51| 85| 1 --------------------------------------------------------------------------- 51- 85 (60.02/31.36) DSCPAADGSLDSHKARFKEATSQYFSLLSSIDV.RL 93- 128 (55.08/28.30) DDAGALGGDSDSGKSTRTDSSTGTSSSANPMDVsRL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PEPEDFTYLDRIQQLNEVDKDVT 2) RLNSRKD | 7 127 | 29 133 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab