<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13176
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MPITGVYFIPSMPNATTALPAVTERLRAAFTDEELTPIGRWGLEQKLFRDTPGLVPASANSNKKASNPRYMQFLSLTHYPTHGFIYTSEPADLQQTVAANLNSNGNPTPAPAQSPAATTPTQNQNQHQNANGIQHGITTTPDHPKMIMTTIPPASYTSLFQHFTYACQPFWCHRLTVTVPNGIVYDIGDFRVRLGDVRQTVPTARVRGTVVEIEWRGPSVVEALPGFDQGQQENHSGGIGASPSSGGDDSGVEFSFSDIEESDVEAEYLATAQLIREFWGRLGLEAKEAVLVPGIGKEVLERLRRVKGGESLQKDGERRVGDVVGSERFEEDLDPSAGTDVARQFMEVLRFNR |
| Length | 353 |
| Position | Head |
| Organism | Penicillium antarcticum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.437 |
| Instability index | 46.43 |
| Isoelectric point | 5.27 |
| Molecular weight | 38680.72 |
| Publications | PubMed=28368369
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13176
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 95.21| 27| 130| 5| 31| 1
---------------------------------------------------------------------------
5- 31 (48.12/33.53) GVYFIPSMPN..ATTALPAVTERLRAAFT
136- 164 (47.09/32.65) GITTTPDHPKmiMTTIPPASYTSLFQHFT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.14| 18| 19| 87| 104| 3
---------------------------------------------------------------------------
87- 104 (29.15/18.99) TSEPADLQQTVAANLNSN
108- 125 (31.99/21.56) TPAPAQSPAATTPTQNQN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.79| 16| 239| 39| 54| 5
---------------------------------------------------------------------------
39- 54 (31.90/22.08) GRWGLEQKLFRDTPGL
280- 295 (27.89/18.45) GRLGLEAKEAVLVPGI
---------------------------------------------------------------------------
|