<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13165

Description Uncharacterized protein
SequenceMIPHSSAGGQSWGHPLRTFNGGPGRVDNAQMLGQYDQPDRSASLPQPPIRQPVVVDLTAGGPESQDREPPPKRPRLDVPSASHTSDTGAAVGETRSTPGSAISRPAVSWRGRPAWSFQAVVSEIPSHENRGDGTAGSKPPSPPPLPAQPWMNNFVAEPEGSGVVKSRESSPVGAVQTTPYRIEIPSVAPVYKGQKPADFAPWTGNHPEDVLSEQTAKQGYYDRTQVSQNESNTARPALYAQLKNRTGLQMLSSVFAAALEKRQSHNTIHAPSTFKPPPRVTLTDNKREAWLRDLANPSVPLRRLSRTIPHGIRGKILLDQCLGKWIPIARAVWLAKCVGANEIRAFKRKGTSGALAVGLEAKWVRDWTTNVQQFVEGVFAAPKSSDWKAKMTYAVGLTARLFSENLLDHDHFLEWFLSSFEAASIGTIPVWLLMLGVYWNSIMRYRRRGRRLAELLLQKVRQATEAKLTQLQPLIDRLSRFIKKLVLDHTSSMILPNSWETYHQQVSSALDLGNEAEKVLFQSLAERNARVQRPRHSKQTTQRSPHQRIVRLLDSIRSAQDLSSVFGYLDAFDDKAVLVFKLLEWLSTPFRHGLCRVYIGVRLLRKWKLAGVDIDSHILAFLSRGQNNQKLNMDQIYHVVSELVRSQTFSVGRYLQWLMARGVTNGSSSAEERKVKDLPIDIGLIAQLPVARLPEHVGNLRSTLLTRAGLSTSEENAAIDSVKEIISQRLPGIFGVHESASMALDSVPPNLPWAVKAEVGQWLRRAIAEHNRSAESTNRGAFPVGIASVVSALTPAEFYTVRDALESFGDISMLADVLKFASSCGDGTVLASVADTTNCHFDSLCVIGATTDLFRRLIDAYAGMKRFGMPSLDLIFSLIELGLRIPSDLNTVSILRQDLSRMENKAIMAASSPVSDHIPDGFGGVDPFFREKLDQLLQSGNVMDEPTLDAIFNILIKHLESGDGHENLSANDTCRYLAQLRSFHPKHFDGILARWVCGHLRSPERTILLRILPPLIGVGCVTIRAFLALAKKLALSKPATVPNAAQLPADLVQLLVSGDEDSKSFDLVSYRFQLAQQEFLNKNSEEALKIVCDAASSNAGSSSTGHTEMEHSIIMLLRDLLVRHPECAAQNGMQKLMDQYPAALSIVQKALDLLLGIESQSDGSSVLSKVEKLACMTDDFSLPFCQLKLQVLFHADSGSEDRTNIVDAMFKTAVSDCRAHRLHWVDLVALMSPDAVRQIRERAEKEFFSIPLLEEPVGDIPDSPDKLGSLETAKMYLTIIEELASSIPDSGAPSVAPVLVEKMDSLLHKIITMHNSTPAKGVANTDRSKLERALAFWFSALLRIIVLHRSAFSQPPPALKINPLHEQLRLLTSVFCIALSRLPGDILRLFPAADYFPHPTPAEGFRPCPGILLQTHALDVAASLIDIFPDEVRHQCARFLKEKCPSFVPFQNDSRFLYLLGPISDQYPANPHQASAPSPAASGSTPTPTPSLFSIAGSSTAQQSATTVSGPSTAPPDSNSMANRLRLQHRGRVVGPYPLRPWELLEDAAPFLGVNDTAVNLGFFDARRVRA
Length1571
PositionKinase
OrganismPenicillium polonicum
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
Aromaticity0.07
Grand average of hydropathy-0.183
Instability index49.14
Isoelectric point8.58
Molecular weight172827.55
Publications
PubMed=28368369

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP13165
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     141.94|      30|      35|    1305|    1339|       1
---------------------------------------------------------------------------
  918-  946 (51.18/30.28)	IPD.GFGGVDPFFREK.....LDQLLQSGNVMDEP
 1287- 1316 (51.68/30.66)	IPDSGAPSVAPVLVEK.....MDSLLHKIITMHNS
 1317- 1350 (39.07/33.65)	TPAKGVANTDRSKLERalafwFSALL.RIIVLHRS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.92|      21|      35|     356|     376|       2
---------------------------------------------------------------------------
  356-  376 (38.13/28.96)	AVGLEAKWVRDWTTNVQQFVE
  394-  414 (35.79/26.66)	AVGLTARLFSENLLDHDHFLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     156.13|      34|      35|    1449|    1482|       3
---------------------------------------------------------------------------
 1387- 1410 (24.22/ 9.28)	........LRLF.PAADYFPhPT.PAEGFRPCPG..
 1413- 1438 (21.94/ 7.53)	.LQTHA..LDVAASLIDIFP.DEvRHQ.CAR.....
 1449- 1482 (60.21/36.91)	PFQNDSRFLYLLGPISDQYP.AN.PHQASAPSPAAS
 1486- 1518 (49.76/28.89)	PTPTPSLF.SIAGSSTAQQS.AT.TVSGPSTAPPDS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.05|      19|      73|      56|      77|       4
---------------------------------------------------------------------------
   56-   77 (32.14/22.95)	DLTAGG.PESqdrEPP.PKRPRLD
  132-  152 (32.91/16.05)	DGTAGSkPPS...PPPlPAQPWMN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     157.00|      42|      73|     662|     703|       5
---------------------------------------------------------------------------
  658-  699 (68.16/48.72)	LMARGVTN.GSSSAEERKVKDLPIDI.GLIAQLPVARLPEHVGN
  700-  732 (37.73/22.90)	LRSTLLTRaGLSTSEENAAIDSVKEI...ISQ....RLPG....
  735-  773 (51.11/34.25)	....GVHE.SASMALDSVPPNLPWAVkAEVGQWLRRAIAEHNRS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.42|      27|      37|    1134|    1166|       6
---------------------------------------------------------------------------
 1134- 1162 (39.22/30.36)	QKL...MDQYpaALSIVQKALDLLLGIESQSD
 1171- 1200 (42.20/17.90)	EKLacmTDDF..SLPFCQLKLQVLFHADSGSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.71|      19|      42|     786|     809|      10
---------------------------------------------------------------------------
  786-  809 (22.32/27.63)	IASVVSAlTPAEFytvrDALESFG
  830-  848 (35.39/22.45)	LASVADT.TNCHF....DSLCVIG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP13165 with Med12 domain of Kingdom Fungi
Unable to open file!