<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13155

Description Uncharacterized protein
SequenceMSLTNPPSSSGSLSRTRVGNLKRSLQATVDDAIESRRPGGYTSKVRVRDRYNIVGFISSGTYGRVYKAVGKNGKKGEFAIKKFKPDKEGETIQYTGLSQSAIREMALCTELSHANVVQLEEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHAIPATMVRSIMFQLLNGLLYLHTNWVLHRDLKPANILVTSSGAIRIGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLMGSRHYTPAVDMWAIGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIVEILGLPRKESWPGLASMPEYSQLQSLMLHRQPSHFHRGSNLEGWYQSCLKNGGYTSTSGAGTPGADGFDLLSRMLEYDPSKRITAEQALEHPYFTNGGPISGNCFEGIEGKYPHRRVTQDDNDIRTGSLPGTKRSGLPDDSLMRASKRLKE
Length437
PositionKinase
OrganismPenicillium polonicum
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
Aromaticity0.08
Grand average of hydropathy-0.397
Instability index42.08
Isoelectric point9.34
Molecular weight49022.65
Publications
PubMed=28368369

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP13155
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     120.76|      37|      85|     202|     251|       1
---------------------------------------------------------------------------
  202-  251 (57.52/57.96)	LGLARLF..........YKPLNSLfsgdkvvvtIWYRAPELLmgsrHYTPAVDMWAIGCI
  289-  335 (63.24/36.54)	LGLPRKEswpglasmpeYSQLQSL.........MLHRQPSHF....HRGSNLEGWYQSCL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.96|      15|      42|     337|     353|       3
---------------------------------------------------------------------------
  337-  353 (24.95/20.69)	NGGytSTSGAGTPGADG
  382-  396 (31.00/17.80)	NGG..PISGNCFEGIEG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP13155 with CDK8 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) FEGIEGKYPHRRVTQDDNDIRTGSLPGTKRSGLPDDSLMRASKRLKE
391
437










Molecular Recognition Features






MoRF SequenceStartStop




NANANA