<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13141
| Description |
Mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MPPGAFAGTQAQAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHTGTYQDRLGKLQEHLRQLSILFRKLRLVYDKCNENCAGLDPVPIEQLIPYVEEDGSKHDDRGAASQLRFASEERREIMEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
| Length | 169 |
| Position | Head |
| Organism | Patagioenas fasciata monilis |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Columbiformes> Columbidae> Patagioenas.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.551 |
| Instability index | 44.63 |
| Isoelectric point | 8.46 |
| Molecular weight | 19515.22 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13141
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.25| 21| 71| 66| 86| 1
---------------------------------------------------------------------------
66- 86 (35.37/21.19) KLQEHLRQLSILFRKLR.LVYD
139- 160 (32.88/19.30) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|