<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13137
| Description |
Uncharacterized protein |
| Sequence | MLRGAADVKGSASGVRRELRRPPPAMVVPALDAPAPPPGAMVADVVFVIEGTANLGPYFESLRKHYLLPAIE |
| Length | 72 |
| Position | Unknown |
| Organism | Patagioenas fasciata monilis |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Columbiformes> Columbidae> Patagioenas.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | 0.142 |
| Instability index | 80.90 |
| Isoelectric point | 8.21 |
| Molecular weight | 7607.84 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13137
No repeats found
No repeats found
|