<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13137
Description |
Uncharacterized protein |
Sequence | MLRGAADVKGSASGVRRELRRPPPAMVVPALDAPAPPPGAMVADVVFVIEGTANLGPYFESLRKHYLLPAIE |
Length | 72 |
Position | Unknown |
Organism | Patagioenas fasciata monilis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Columbiformes> Columbidae> Patagioenas.
|
Aromaticity | 0.06 |
Grand average of hydropathy | 0.142 |
Instability index | 80.90 |
Isoelectric point | 8.21 |
Molecular weight | 7607.84 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP13137
No repeats found
No repeats found
|