<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13134
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MDAGPVLIHVMKALLNESVSVMERYCFFSCLNMYDTGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKEPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSVK |
Length | 155 |
Position | Middle |
Organism | Patagioenas fasciata monilis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Columbiformes> Columbidae> Patagioenas.
|
Aromaticity | 0.15 |
Grand average of hydropathy | -0.435 |
Instability index | 36.53 |
Isoelectric point | 8.75 |
Molecular weight | 18794.59 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13134
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.00| 17| 20| 42| 61| 1
---------------------------------------------------------------------------
45- 61 (30.83/19.43) ELEFVQCLANPNYLNFL
63- 79 (27.17/ 9.56) QRGYFKDKAFVNYLKYL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 65.81| 20| 20| 89| 108| 2
---------------------------------------------------------------------------
89- 101 (17.51/ 6.94) .........KYLKYPQCLHMLE
102- 122 (29.51/15.95) LLQYEHF.rKELVNAQCAKFID
126- 143 (18.79/ 7.90) ILHWQHYsrKRMRLQQAL....
---------------------------------------------------------------------------
|