<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13120
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MFGSQPPGPPPPGPPGGPGPAGLIPPPTGPRNPNNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLAKLRHWQQVLEDISVQHKKPAEMPQGPLVYLEQASATIPAPMKQT |
| Length | 171 |
| Position | Head |
| Organism | Patagioenas fasciata monilis |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Columbiformes> Columbidae> Patagioenas.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.577 |
| Instability index | 55.98 |
| Isoelectric point | 5.42 |
| Molecular weight | 18939.37 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13120
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.11| 15| 18| 135| 151| 1
---------------------------------------------------------------------------
135- 151 (22.74/19.48) V.LEDISvqHKKPAEMPQ
155- 170 (21.37/11.57) VyLEQAS..ATIPAPMKQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.42| 15| 17| 98| 112| 3
---------------------------------------------------------------------------
98- 112 (24.48/17.66) QKPEQVIKEDVSELR
116- 130 (23.94/17.13) QRKEALIQKHLAKLR
---------------------------------------------------------------------------
|