<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13120

Description Mediator of RNA polymerase II transcription subunit 28
SequenceMFGSQPPGPPPPGPPGGPGPAGLIPPPTGPRNPNNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLAKLRHWQQVLEDISVQHKKPAEMPQGPLVYLEQASATIPAPMKQT
Length171
PositionHead
OrganismPatagioenas fasciata monilis
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Columbiformes> Columbidae> Patagioenas.
Aromaticity0.05
Grand average of hydropathy-0.577
Instability index55.98
Isoelectric point5.42
Molecular weight18939.37
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP13120
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.11|      15|      18|     135|     151|       1
---------------------------------------------------------------------------
  135-  151 (22.74/19.48)	V.LEDISvqHKKPAEMPQ
  155-  170 (21.37/11.57)	VyLEQAS..ATIPAPMKQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.42|      15|      17|      98|     112|       3
---------------------------------------------------------------------------
   98-  112 (24.48/17.66)	QKPEQVIKEDVSELR
  116-  130 (23.94/17.13)	QRKEALIQKHLAKLR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP13120 with Med28 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MFGSQPPGPPPPGPPGGPGPAGLIPPPTGPRNPNNTLV
1
38










Molecular Recognition Features






MoRF SequenceStartStop




NANANA