<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13119

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMAPVQLESNQLVPAGGGPASAPAPPAPGAVTAAASPGYRLSTLIDFLLHRTYAELTVLADLLPRKTDMERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKSEKQTTLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLEILVEDKETGDGRALVHSMQINFIHQLVQSRLFADEKPLQDMYNCLHSFCLALQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTGTASVHKVTIKIDETDVSKPLQISHEPPLPACDSKLMERAMKIDHLSIEKLLIDSVHARSHQKLQELKAILKSYNTNDNSFIETALPTLVIPILEPCGRSECLHVFVDLHSGMFQLMLYGVDQLTLDDIEKSVNDDMKRIIPWLQQLKFWLGQQRCKQSIKHLPTVSSETLQLANYANHPVGNLSKHKLFIKLTRLPQYYIVVEMFDVPGNPTELEYKYHFLSVSYAEGDDSPATALLLQQFKPNIEELVLDTKSGKQMKSGVKRKLSGDPCSIEPKKPKRSGEMCAFNKVLAHIVAMCDTNMPFIGLRLELSNMDIPHQGVQVEGDGFSHSIRLLKIPPCKGVNEETQKALDRSLLDCTFRLQGRNNRTWVAELVFANCPLNSTSSREQGPTRHVYLTYENQLSEPVGGRKVVEMFLNDWNSIARLYECVLEFARSLPDIPNHLNIFSEVRIYNYRKLILCYGTTKGSSISIQWNSMLQKFHISLGTVGPNSGCSNCHNTILHQLQEMFNKTPNVVQLLQVLFDTQAPLNAINKLPTVPMLGLTQRTNTAYQCFSILPQSPTHIRLAFRNMYCIDIYCRSRGVVAIRDGAYSLFDNSKIVEGFYPAPGLKTFLNMFVDSNQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPQQQPQQPQQQPFAKQGGASGAYPLTSPPTSYHNTVTPSPSMMHTQSPGNLHAASSPSGALRAPSPASFGPTPSPSSLGITMGQTANFASPHGTIDPSSPYTMMSPSQRAGNWPGSPQVSGPSPAARMPGMSPANPSLHSPVPDASHSPRAGTSSQAMPTSMPPPRKLPQRSWAASIPTILTHSALNILLLPSPTPGLVPGLAGSYLCSPLERFLGSVIMRRHLQRIIQQETLQLINSNEPGVIMFKTEALKCRVALNPKTNQTLQLKVTPENTGQWKSEELQVLEKFFETRVAGPPFKANTLIAFTKLLGAPTHILRDCVHIMKLELFPDQASQLKWNVQFCLTIPPSAPPIAPPGTPAVVLKSKMLFFLQLTQKTTVPQEAVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAELNSSRPGECTIFAAVRDLMVNLTLPPGGRP
Length1447
PositionTail
OrganismPatagioenas fasciata monilis
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Columbiformes> Columbidae> Patagioenas.
Aromaticity0.06
Grand average of hydropathy-0.195
Instability index54.25
Isoelectric point8.83
Molecular weight160303.30
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP13119
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     292.38|      68|     282|    1047|    1114|       1
---------------------------------------------------------------------------
  978- 1066 (92.64/35.18)	G.GDMMDSLISQLQPQ.Q..QPQQPQQQPFA...KQggASGAYPlTS.PPTSyhntvTPSPsmmhtqspgnlhaassPSGALRAPSPASFGPTPSPS
 1067- 1124 (108.34/42.30)	SLGITMGQTANFASPH.GTIDPSSPYTMMSP...SQ..RAGNWP.GS.PQVS.....GP..........................SPAARMPGMSPA
 1127- 1203 (91.39/34.62)	SLHSPVPD.ASH.SPRaGTSSQAMPTSMPPPrklPQ..R..SWA.ASiPTIL.....THSA........lnilllpsPTPGLVPGLAGSYLCSPLER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.29|      31|     282|     467|     514|       4
---------------------------------------------------------------------------
  483-  513 (55.34/61.19)	QQLKFWLGQQRCKQSIKHLPTVSSETL.QLAN
  856-  887 (48.96/18.43)	QLLQVLFDTQAPLNAINKLPTVPMLGLtQRTN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.65|      23|      29|     235|     257|       6
---------------------------------------------------------------------------
  235-  257 (35.56/24.15)	RLLKLEILVEDKETGDGRALVHS
  265-  287 (40.09/28.19)	QLVQSRLFADEKPLQDMYNCLHS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.53|      12|      30|     348|     359|       9
---------------------------------------------------------------------------
  348-  359 (20.25/12.49)	IKIDETDVSKPL
  379-  390 (20.28/12.52)	MKIDHLSIEKLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.68|      27|     508|     318|     344|      11
---------------------------------------------------------------------------
  318-  344 (49.82/37.84)	YHAGKCLSLSV.WNQQV.........LGRKTGTASVH
  801-  837 (40.86/29.47)	YGTTKGSSISIqWNSMLqkfhislgtVGPNSGCSNCH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.28|      18|     402|     893|     915|      20
---------------------------------------------------------------------------
  893-  915 (26.26/32.13)	FSILPQSPTHIrlaFRNmyCIDI
 1296- 1313 (35.02/22.50)	FTKLLGAPTHI...LRD..CVHI
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP13119 with Med14 domain of Kingdom Metazoa

Unable to open file!