<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13109
| Description |
Uncharacterized protein |
| Sequence | MIGLSMLQIEYNASMIVRLVEELLSVSRTLKENWILGQLPKTNEADNVDPLDGMDDKINEVLKRILHTKQFDEEVEDDESEEEEEEEEEQEPQEQQKQEQEVIPEIKSEIKVEAPSDDIMDGMITAAVDEATNEKKVEVKQEETGADSNATTEATTTNGAHDGNGGETNATNGEPEPQIPPIEDVIEIADDVLGQYDFDNFGDMGDDVNDIIMLD |
| Length | 215 |
| Position | Head |
| Organism | Cyberlindnera fabianii (Yeast) (Hansenula fabianii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Phaffomycetaceae> Cyberlindnera.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.802 |
| Instability index | 53.91 |
| Isoelectric point | 4.05 |
| Molecular weight | 23996.76 |
| Publications | PubMed=28385833
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13109
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 107.31| 29| 82| 77| 110| 2
---------------------------------------------------------------------------
77- 110 (38.39/26.64) D.......DESEEEEEEEEEQEPqeQqkqEQEVIPEIKSEI
121- 153 (26.61/ 8.93) DgmitaavDEATNEKKVEVKQE.......ETGADSNATTE.
162- 186 (42.32/18.08) D.......GNGGETNATNGEPEP..Q.......IPPIEDVI
---------------------------------------------------------------------------
|