Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MAGAETETKGHQDPFVEARLEALHEIDTKLVSILDHSSSALENLTNLKKNASNPDKIAAIQKDFETDVQNFYRDLEYASINLKKEIKTLDDRSGKTDANGITMLPININRKATWAGRAKMETQVDELKQLLEKKTGTDSA |
Length | 140 |
Position | Head |
Organism | Cyberlindnera fabianii (Yeast) (Hansenula fabianii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Phaffomycetaceae> Cyberlindnera. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.709 |
Instability index | 19.38 |
Isoelectric point | 5.42 |
Molecular weight | 15616.36 |
Publications | PubMed=28385833 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13106 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 145.52| 47| 54| 29| 76| 1 --------------------------------------------------------------------------- 29- 76 (71.89/49.27) KLVSILDHSSSALE..NLTNLKKNASNPDKIAAIQKdFETDVQNFYRDLE 84- 132 (73.63/45.98) KEIKTLDDRSGKTDanGITMLPININRKATWAGRAK.METQVDELKQLLE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) NLTNLKK 2) PDKIAAIQKDFETDVQNFYRDLEYASINLKKEIKTLDDRSGKTDANGITMLPININRKATWAGRAKMETQVDELKQLLEKK | 43 54 | 49 134 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab