<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13085

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMNKQLDLCFDRVEKALGTLIDSIAKYNPSVTQVQELGNADIELTKGLQDLQTHQSNYLRIQDLRASTAKYDAQIKDTLRLLANTRKELVNASATAFPDGPNYEIQYDELLSYARRISKTTIPPVGALNAISAAIGESSQAKGEISAPETAATTPAGGTPNGTTPQPLAAVANGDASQQTNTTNLPEPLATFLNPHSAFTFVPWPTEEQVRHGAIASLAYMAEQGIEAEGYDPEVEKARKEREEEERKQAEERERADREERERRMREEQARIRTERERNREKEEAENRRRANVPVGGGAQQQQQPGGPAASGSPTQAQPKTQFHFMGDDDDDDDD
Length334
PositionMiddle
Organismfungal sp. No.14919
KingdomFungi
LineageEukaryota> Fungi.
Aromaticity0.05
Grand average of hydropathy-0.942
Instability index54.87
Isoelectric point4.86
Molecular weight36902.00
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364141

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP13085
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      74.04|      15|      15|     238|     252|       1
---------------------------------------------------------------------------
  238-  252 (26.32/11.57)	RKERE.EEERKQAEER
  254-  268 (26.46/11.65)	RADRE.ERERRMREEQ
  272-  287 (21.26/ 8.23)	RTERErNREKEEAENR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.76|      18|      18|     150|     167|       2
---------------------------------------------------------------------------
  150-  167 (34.51/15.87)	A.ATTPAGGTPNGTT.PQPL
  169-  188 (24.25/ 9.46)	AvANGDASQQTNTTNlPEPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.40|      15|      26|      80|     100|       3
---------------------------------------------------------------------------
   80-  100 (16.25/30.89)	LLANTRKelvnASATAFPdgP
  109-  123 (27.15/20.18)	LLSYARR....ISKTTIP..P
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP13085 with Med4 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) SSQAKGEISAPETAATTPAGGTPNGTTPQPLAAVANGDASQQTNTTNLPEPLATFLNPHSAFTFVPWPTEEQVRHGAIASLAYMAEQGIEAEGYDPEVEKARKEREEEERKQAEERERADREERERRMREEQARIRTERERNREKEEAENRRRANVPVGGGAQQQQQPGGPAASGSPTQAQPKTQFHFMGDDDDDDDD
137
334










Molecular Recognition Features






MoRF SequenceStartStop




1) ANVPV
2) QPGGPAASGSPTQAQPKTQFHFMGDDDDDDDD
290
303
294
334