<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13066
| Description |
mediator of RNA polymerase II transcription subunit 19a-like isoform X2 |
| Sequence | MDSEGQKFGRGPRELSGAVDLVSRYNLLVHHDFFCKKHLPMSILDTHYLHTVVGGTEIRKGEGMLLGQLIQNTSYNRETNVHLQPFDLDILTDAFDLRETTPVELPENEKGVPTIFGKSKGEAKDKDKDKEKEKKHKKRKDREKDKNKENKKLKHRHKDKDKETKKDRSSIMIHSKKHHEKKGWKFVTSFEAIA |
| Length | 194 |
| Position | Head |
| Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.161 |
| Instability index | 30.81 |
| Isoelectric point | 9.47 |
| Molecular weight | 22554.47 |
| Publications | PubMed=25893780
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13066
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 54.98| 10| 14| 124| 133| 1
---------------------------------------------------------------------------
124- 133 (19.30/ 8.30) KDKDKDKEKE
140- 149 (18.48/ 7.70) KDREKDKNKE
156- 165 (17.20/ 6.77) RHKDKDKETK
---------------------------------------------------------------------------
|