<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13063
Description |
mediator of RNA polymerase II transcription subunit 19a-like isoform X1 |
Sequence | MFHESLTHGFGRPEIWKSLGPRELSGAVDLVSRYNLLVHHDFFCKKHLPMSILDTHYLHTVVGGTEIRKGEGMLLGQLIQNTSYNRETNVHLQPFDLDILTDAFDLRETTPVELPENEKGVPTIFGKSKGEAKDKDKDKEKEKKHKKRKDREKDKNKENKKLKHRHKDKDKETKKDRSSIMIHSKKHHEKKGWKFVTSFEAIA |
Length | 203 |
Position | Head |
Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -1.070 |
Instability index | 31.60 |
Isoelectric point | 9.47 |
Molecular weight | 23672.80 |
Publications | PubMed=25893780
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP13063
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 54.98| 10| 14| 133| 142| 1
---------------------------------------------------------------------------
133- 142 (19.30/ 7.85) KDKDKDKEKE
149- 158 (18.48/ 7.27) KDREKDKNKE
165- 174 (17.20/ 6.36) RHKDKDKETK
---------------------------------------------------------------------------
|