<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13057
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MATPPGAAGGNFEAPPPPPMQPPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPLYDWTCNNEQLRMRSIHPLDLSQLSKMTGMEYMLSEVMEPHLFVIRKQKRDSAEKVTPMLAYYILDGSIYQAPQLCNVFAARVGRALYYILKAFTTAASKLEKIGYVDTENESETVEPKGGKEAIDFKEVKRVDHILASLQRKNLFCS |
| Length | 204 |
| Position | Head |
| Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.291 |
| Instability index | 42.34 |
| Isoelectric point | 5.95 |
| Molecular weight | 23108.39 |
| Publications | PubMed=25893780
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13057
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.66| 20| 30| 23| 44| 1
---------------------------------------------------------------------------
23- 44 (37.09/31.92) PGTDMTgiCFRDQLWLNT.YPLD
56- 76 (37.57/25.09) PLYDWT..CNNEQLRMRSiHPLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.88| 22| 24| 109| 131| 2
---------------------------------------------------------------------------
109- 131 (35.66/29.40) AEKVTPMLaYYILDGSIYQAPQL
136- 157 (35.22/23.90) AARVGRAL.YYILKAFTTAASKL
---------------------------------------------------------------------------
|