<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13054
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MATPPGAAGGNFEAPPPPPMQPPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPLYDWTCNNEQLRMRSIHPLDLSQLSKMTGMEYMLSEVMEPHLFVIRKQKRDSAEKVTPMLAYYILDGSIYQAPQLCNVFAARVGRALYYILKAFTTAASKLEKIGYVDTENESETVEPKGGKEAIDFKEVKRVDHILASLQRKVTYITQNLCLCSYFNLNFYDGIRSVIRGTNIFHFGFYCFVVHFSVCIESILFMILKTCITPVSRWLCSAFNSRSRERSRKPANSRASTFCC |
Length | 290 |
Position | Head |
Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.116 |
Instability index | 49.49 |
Isoelectric point | 8.58 |
Molecular weight | 33098.97 |
Publications | PubMed=25893780
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP13054
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.66| 20| 30| 23| 44| 1
---------------------------------------------------------------------------
23- 44 (37.09/30.70) PGTDMTgiCFRDQLWLNT.YPLD
56- 76 (37.57/24.08) PLYDWT..CNNEQLRMRSiHPLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.88| 22| 24| 109| 131| 2
---------------------------------------------------------------------------
109- 131 (35.66/29.82) AEKVTPMLaYYILDGSIYQAPQL
136- 157 (35.22/24.24) AARVGRAL.YYILKAFTTAASKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.80| 24| 55| 189| 214| 3
---------------------------------------------------------------------------
189- 214 (38.52/28.78) VDHIL.ASLQRKVTYITQNlcLCSYFN
246- 270 (40.28/23.19) IESILfMILKTCITPVSRW..LCSAFN
---------------------------------------------------------------------------
|