<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13051
Description |
mediator of RNA polymerase II transcription subunit 19a-like isoform X2 |
Sequence | MDPEGKKFGGGPRELSGAVDLISHYKLLPHHDFFCKRPLPVSISDTHYLHNVVGDTEIRKGEGMQLDQLIQNTSHNRDSNVRIQPFDLDILKEAFQLSETTPVELPVSEKGIPTIAGKSKSEAKDKDRKHKKHKDRDKDKDKEHKKHKHRHKDKDRSKDKDKEKKKDRSGHHDSGADHSKKHHEKKRKHDGDEDLSDVHRHKKT |
Length | 204 |
Position | Head |
Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -1.555 |
Instability index | 39.01 |
Isoelectric point | 9.37 |
Molecular weight | 23599.13 |
Publications | PubMed=25893780
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13051
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.23| 15| 15| 125| 139| 1
---------------------------------------------------------------------------
125- 139 (29.49/ 9.55) DKDRKHKKHKDRDKD
141- 155 (27.74/ 8.58) DKEHKKHKHRHKDKD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.78| 17| 19| 156| 173| 2
---------------------------------------------------------------------------
156- 173 (26.04/14.78) RSKdKDKEKKKDRSGHHD
178- 194 (32.74/14.79) HSK.KHHEKKRKHDGDED
---------------------------------------------------------------------------
|