<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13050
| Description |
mediator of RNA polymerase II transcription subunit 19a-like isoform X1 |
| Sequence | MDAGGNKFGGGPRELSGVVDLISRYKLLPHHDFFCKRPLPLSIADTHYLHNVAGDTEIRKGEGMQLDQLNQNTSHNRDTNARIQPFDFDILKEAFQLRETTPVELPPTEKGMPTIAGKSKGEVKDKERKHKKHKDRDKEKDKERKKHKHCHKDKDRSKDKDKEKKKDRNGHHGSGADHLKKHHEKKRKHDGDEVRNDINRHKKSKKMGVGRAFGWHERFSC |
| Length | 221 |
| Position | Head |
| Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.507 |
| Instability index | 34.75 |
| Isoelectric point | 9.72 |
| Molecular weight | 25620.65 |
| Publications | PubMed=25893780
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP13050
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.28| 23| 33| 147| 178| 1
---------------------------------------------------------------------------
147- 174 (34.22/27.71) HkhchKDKDRSKDKDkEKKKDRNGHHGS
182- 204 (40.06/11.53) H....HEKKRKHDGD.EVRNDINRHKKS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.68| 13| 14| 118| 130| 2
---------------------------------------------------------------------------
118- 130 (22.97/12.14) KSKGEVKDKERKH
134- 146 (22.71/11.92) KDRDKEKDKERKK
---------------------------------------------------------------------------
|