<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13049
| Description |
mediator of RNA polymerase II transcription subunit 19a-like isoform X2 |
| Sequence | MDPEGKKFGGGPRELSGAVDLISHYKLLPHHDFFCKRPLPVSISDTHYLHNVVGDTEIRKGEGMQLDQLIQNTCHNRDSNVRIQPFDLDILKEAFQLSETTPVELPVSEKGIPTIAGKSKSEAKDKDRKHKKHKDRDKDKDKEHKKHKHRHKDKDRSKDKDKEKKKDRSGHHDSGADHSKKHHEKKRKHDGDEDLSDVHRHKKT |
| Length | 204 |
| Position | Head |
| Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.539 |
| Instability index | 40.61 |
| Isoelectric point | 9.33 |
| Molecular weight | 23615.20 |
| Publications | PubMed=25893780
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13049
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 94.66| 19| 19| 125| 143| 1
---------------------------------------------------------------------------
125- 143 (36.48/12.04) DKDRKHKKHKD.RDKDKDKE
165- 181 (30.19/ 8.83) KKDR..SGHHD.SGADHSKK
184- 203 (27.99/ 7.71) EKKRKHDGDEDlSDVHRHKK
---------------------------------------------------------------------------
|