<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13048
| Description |
mediator of RNA polymerase II transcription subunit 19a-like isoform X1 |
| Sequence | MDPEGKKFGGGPRELSGAVDLISHYKLLPHHDFFCKRPLPVSISDTHYLHNVVGDTEIRKGEGMQLDQLIQNTSHNRDSNVRIQPFDLDILKEAFQLSETTPVELPVSEKGIPTIAGKSKSEAKDKDRKHKKHKDRDKDKDKEHKKHKHRHKDKDRSKDKDKEKKKDRSGHHDSGADHSKKHHEKKRKHDGDEDLSDVHRHKKSKHKSSKIDEVGAIKVAG |
| Length | 221 |
| Position | Head |
| Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.468 |
| Instability index | 36.80 |
| Isoelectric point | 9.45 |
| Molecular weight | 25334.12 |
| Publications | PubMed=25893780
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP13048
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.58| 15| 15| 125| 139| 1
---------------------------------------------------------------------------
125- 139 (28.15/ 8.77) DKDRKHKKHKDRDKD
141- 155 (27.89/ 8.62) DKEHKKHKHRHKDKD
178- 192 (24.54/ 6.67) HSKKHHEKKRKHDGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.68| 15| 37| 162| 176| 3
---------------------------------------------------------------------------
162- 176 (27.03/11.38) KEKKKDRSGHHDS.GA
201- 216 (21.65/ 7.74) HKKSKHKSSKIDEvGA
---------------------------------------------------------------------------
|