<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13040
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASTKESDNASDTPSSPKNVYKDPDDGRQRFLLELELVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNANFRNAMAHPANKEVAHRQQFFFWKNYRNNRLKFILPKPPPEEVPTPAPLPPASAPPQQSLPASNIAMTTAPPAPASTHSPMPYGLPSGSALAKNDMRNSGIDRRKRKHERSLN |
| Length | 208 |
| Position | Middle |
| Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.736 |
| Instability index | 63.28 |
| Isoelectric point | 9.26 |
| Molecular weight | 23938.94 |
| Publications | PubMed=25893780
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP13040
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.40| 12| 15| 48| 62| 1
---------------------------------------------------------------------------
48- 62 (17.73/15.67) HYLAQNRYFEdeaFI
69- 80 (24.67/13.10) QYWQRPEYIK...FI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.48| 17| 24| 140| 156| 2
---------------------------------------------------------------------------
140- 156 (34.93/12.66) TPAPLPPAS..APPQQSLP
163- 181 (30.55/10.37) TTAPPAPASthSPMPYGLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.77| 24| 26| 86| 109| 3
---------------------------------------------------------------------------
86- 109 (40.48/24.56) LYFLELLQNANFRNAMAHPANKEV
115- 138 (45.29/28.36) FFFWKNYRNNRLKFILPKPPPEEV
---------------------------------------------------------------------------
|