| Description | mediator of RNA polymerase II transcription subunit 32-like |
| Sequence | MDNIVDSLNKAYQEFVAAAANVLETKGSSAAQKTESTDTALESFKQKWETFGLACDQAEEFVESIKQRIGSECLVDEATGNSSERLTGLPPISAVRLEQMSKAVRWLVIELQNGSGTAAAHPSTPFDGRFSEDGGQ |
| Length | 136 |
| Position | Tail |
| Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.401 |
| Instability index | 60.11 |
| Isoelectric point | 4.54 |
| Molecular weight | 14645.01 |
| Publications | PubMed=25893780 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro leaf senescence GO:0010150 IEA:InterPro regulation of transcription, DNA-templated GO:0006355 IEA:InterPro root development GO:0048364 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP13026 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) LTGLPPISAVRLEQMSKAVRWLVIEL 2) PFDGRFSE 3) SIKQRI | 86 125 64 | 111 132 69 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab