<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13019

Description U-box domain-containing protein 33-like isoform X2
SequenceMELHNPAHRDSIPGPRFRPRVDRPANTQFPESAEETGGFNAGEKDKVFIAVGKSVERAVNLLQWTLKRFGVGKLPASQANSRVLSAYRKDEKEQLKKLLENYSNFPRKFKVHISIVTIEANQVHKGIVQLVKRHGIRNLVMGAIPENCMSMKKSSSKSSYAAKYVPCFCDIWFVDKGKLVWTREASEEPCLSTPASQAAVTAKSSRSNSLPHRNSDSLVHPDNLRSNSCLTITFAASSTQLTESIVAQTDVSLSPRLSSFSNLSSPRFTNGSKCASSEMRLSLDSYSKDEDENLYRQLGEASMEAKASKNEALAESLKRQKLELEAMEAINKIKDLESARVHEVKLREKAEEALRATVQEREKLIKEKEEAMEELQRTTRNVTLLNGCVQEANCKHDEVAGKLKLIQASIMTLREEKQRIRRQKLEAVRWLERWRSRGQAGATTCNGFIGIVEDLPELAEFSLADVQTATCNFSESFKIGKGGHGCVYKGEMLGRTVAIKKLYPHNMQGQSEFQQEAQVLSKLQHPHLVTLLGVCPEAWSLVYEYVPNGSLQDRLFRKTSVSPLTWKIRARIVAEISSALCFLHSAKPEKIVHGDLKPENILLDSELSCKICDFGISRLVTEDNLYCPSFHCSTEPKGAFPYSDPEFQRIGVPTPKSDIYAFGLIILQVLTRRPPVGLAGEVRKAISSGKLALILDKSAGEWPMFVARRLVDLGLQCCESYGRDRPDLKPSLVRELGQLHVTEERPVPSFFLCPILQEIMHDPQVAADGFTYEGEALRGWLENGRETSPMTNLKLSHLHLTPNHAIRQAIQNWLCKA
Length817
PositionTail
OrganismGossypium hirsutum (Upland cotton) (Gossypium mexicanum)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
Aromaticity0.06
Grand average of hydropathy-0.405
Instability index40.34
Isoelectric point8.78
Molecular weight91522.80
Publications
PubMed=25893780

Function

Annotated function Functions as an E3 ubiquitin ligase. 
ECO:0000256	ARBA:ARBA00003861
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP13019
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.57|      14|      18|     196|     209|       1
---------------------------------------------------------------------------
  196-  209 (22.54/14.96)	SQAAVTAKSSRSNS
  215-  228 (25.03/17.43)	SDSLVHPDNLRSNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.16|      11|      20|     287|     297|       2
---------------------------------------------------------------------------
  287-  297 (20.72/13.60)	SKDE..DENLYRQ
  308-  320 (14.43/ 7.32)	SKNEalAESLKRQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.59|      18|      21|     340|     357|       6
---------------------------------------------------------------------------
  340-  357 (28.00/18.01)	RVHEVKLREKAEEALRAT
  361-  378 (28.59/18.53)	REKLIKEKEEAMEELQRT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.04|      21|     107|     464|     485|       7
---------------------------------------------------------------------------
  464-  485 (34.98/27.60)	ADVQTATCnFSESFKIGKGGHG
  574-  594 (38.06/24.86)	AEISSALC.FLHSAKPEKIVHG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP13019 with Med32 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MELHNPAHRDSIPGPRFRPRVDRPANTQFPESAEETG
1
37










Molecular Recognition Features






MoRF SequenceStartStop




NANANA