<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13006
| Description |
mediator of RNA polymerase II transcription subunit 19a-like isoform X1 |
| Sequence | MDAGGNKFGGGPRELSGVVDLISRYKLLPHHDFFCKRPLPLSIADTHYLHNVAGDTEIRKGEGMQLDQLNQNTSYNRDTNFRIQPFDFDILKEAFQLRETTPVELPPTEKGMPTIAGKSKSEVKDKERKHKKHKDRDKEKDKEHKKHKHRHKDKDRSKDKDKEKKKDRSGHYDSGADHLKKHHEKKRKHDGDEDRNDINRHKKSKSKLVN |
| Length | 210 |
| Position | Head |
| Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.600 |
| Instability index | 38.60 |
| Isoelectric point | 9.62 |
| Molecular weight | 24551.31 |
| Publications | PubMed=25893780
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP13006
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.80| 15| 15| 124| 138| 1
---------------------------------------------------------------------------
124- 138 (28.86/ 8.61) KDKERKHKKHKDRDK
181- 195 (26.94/ 7.66) KHHEKKRKHDGDEDR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.44| 15| 17| 139| 153| 2
---------------------------------------------------------------------------
139- 153 (29.22/11.20) EKDKEHKKHKHRHKD
159- 173 (28.21/10.59) DKDKEKKKDRSGHYD
---------------------------------------------------------------------------
|