<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12959

Description cyclin-dependent kinase E-1-like
SequenceMGDGNNTSGRGIGANNTSSSNSEKLEWLQQYNLLGKIGEGTYGLVFLARIKSPTNRGKCIAIKKFKQSKDGDGVSPTAIREIMLLREISHENVVKLVNVHINHADMSLYLAFDYAEYDLYEIIKHHRDKVNHTMNQYTVKSLLWQLLNGLNYLHSNWIIHRDLKPSNILVMGDGDEHGVVKIADFGLARIYQAPLKPLFENGVVVTIWYRAPELLLGAKHYTSAVDMWAVGCIFAELLTLKPLFQGAEAKSTPNPFQLDQLDKIFKILGHPTLEKWPTLASLPHWQSDVQHIQTHKYENAGLHSVVHLSPKSPAFDLLSKMLEYDPRKRITAAQALEHEYFKIEPLPGRNALVPSQPGEKIINYPTRPVDQNTDFEGTASIQQPPQSVSSGNVAGGMGAHLGRNGSVNRPMPPPMQRMPQGIMAYNFPSQAGVSGGINPGGMPMQRNLATQAHQQQQLRRKDPGMGMTGYPPQQKSRRM
Length479
PositionKinase
OrganismGossypium hirsutum (Upland cotton) (Gossypium mexicanum)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
Aromaticity0.08
Grand average of hydropathy-0.437
Instability index36.81
Isoelectric point9.23
Molecular weight53415.54
Publications
PubMed=25893780

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
nucleus	GO:0005634	IBA:GO_Central
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IBA:GO_Central
RNA polymerase II CTD heptapeptide repeat kinase activity	GO:0008353	IBA:GO_Central
GO - Biological Process
protein phosphorylation	GO:0006468	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP12959
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     145.51|      40|      42|     363|     404|       1
---------------------------------------------------------------------------
  363-  404 (64.17/41.57)	NYPTRPVDQNTDfEGTASIQQPPQSVSSGNVAGGmGAHLGRN
  408-  447 (81.34/43.65)	NRPMPPPMQRMP.QGIMAYNFPSQAGVSGGINPG.GMPMQRN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      98.30|      30|      42|     169|     200|       2
---------------------------------------------------------------------------
  169-  200 (48.76/33.41)	LVMGDGDEHGVVKIADFGLarIYQA..PLKPLFE
  214-  245 (49.54/28.28)	LLLGAKHYTSAVDMWAVGC..IFAEllTLKPLFQ
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP12959 with CDK8 domain of Kingdom Viridiplantae

Unable to open file!