<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12950
| Description |
mediator of RNA polymerase II transcription subunit 6-like |
| Sequence | MATPPVAPSQAAAGGNFEAPPPPAMQPPGTDMTGICFRDQLWLNTYPLDRNLIFDYFALSPFYDWTCNNEKLRMQSIHPLDISQLSKMTGIEYMLSEVMEPHLFIICKQKRDSAEKVTPMLAYYILDGSIYQAPQLCNVFAARVGRALYYISKAFTTAASKLEKIGYVDTENESETSEPKGGKETIDFKEVKRVDHILASLQRKLPPAPPPPPFPDGFVPPTTEAEKEPENQQTTEPQPPAVDPIIDQGPAKRMKF |
| Length | 256 |
| Position | Head |
| Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.438 |
| Instability index | 59.06 |
| Isoelectric point | 5.11 |
| Molecular weight | 28594.40 |
| Publications | PubMed=25893780
|
Function
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP12950
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.13| 11| 24| 114| 125| 5
---------------------------------------------------------------------------
114- 125 (16.93/15.09) AEKVTPMLaYYI
141- 151 (20.20/12.66) AARVGRAL.YYI
---------------------------------------------------------------------------
|