<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12942
Description |
mediator of RNA polymerase II transcription subunit 15a-like isoform X2 |
Sequence | MDTNNWRSTPPSGEPTMDTGDWRTQLQPDSRQRIVNKIMDTLKRHLPFSSQDSLNELRKIAVRFEEKIFTAATSQSDYLKRISLKMLTMENKSQNTVPNTGDNSIPPDPGHAEPSSQSRAINSSLFTK |
Length | 128 |
Position | Tail |
Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.941 |
Instability index | 58.89 |
Isoelectric point | 9.10 |
Molecular weight | 14507.06 |
Publications | PubMed=25893780
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP12942
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.07| 14| 19| 53| 70| 3
---------------------------------------------------------------------------
53- 70 (16.72/20.68) SLNE.LRKIAVrfeeKIFT
74- 88 (18.35/10.70) SQSDyLKRISL....KMLT
---------------------------------------------------------------------------
|