<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12919

Description ATP-dependent DNA helicase
SequenceMEADEIAEELQNIEFEIHDVEEQIRELIEKQEKLYERRSELQVLLETCPIDVKDGSAPTNVQAEDWSRSFDWDSQAEDIRFNVFGISSYRPNQREIINAVMSGRDVLVIMAAGGGKSLCYHPPAILRQGIALVVSPLLSLIQDQVMGLVASGIPARMLTSTTSKEDEKFIYKALEKGEEDLKLLYVTPEKVSKSKRFMSKLEKCHHAGRLSLISIDEAHCCSQWGHDFRPDYKNLGILKTQFPNVPVVALTATATMKVQNDLIEMLHIPKCVKFVSTVNRPNLFYMVREKSSVGKIVVDEIAKYIKESYPNKESGIVYCFSRKECEQVASELCERGISADYYHADMDENAREKVHMRWSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSMETYYQESGRAGRDGLPSECLLFFRSADMPRQSTMVFHENSGLQNLYDMVQYCQSKRQCRRSAFFRHFAEPLQECNGMCDNCAFSSEIKEVDASGHSKLLISLVREMQEKDQRVTMLQLVDRVKNKQKQLDFELKREEMEQLVVQLILDRVLKEEFQHTAYATNSYVTVGPRANQVMLGKKIIKMDVTSTSKDVDGYRKSSKHGVTLGLEFKLDKLRKELASHDKGIFPHSVLSSQQISSISAHLPNSIEELEKIIGKLKTEKYGGRILEEVKKYGNAEHPNNEVLNEEESSEIRPPRKKLKKANKQVIMVDSSNDESD
Length711
PositionUnknown
OrganismGossypium hirsutum (Upland cotton) (Gossypium mexicanum)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
Aromaticity0.07
Grand average of hydropathy-0.477
Instability index46.71
Isoelectric point6.42
Molecular weight81087.89
Publications
PubMed=25893780

Function

Annotated function
GO - Cellular Component
chromosome	GO:0005694	IBA:GO_Central
cytoplasm	GO:0005737	IBA:GO_Central
mediator complex	GO:0016592	IBA:GO_Central
GO - Biological Function
3'-5' DNA helicase activity	GO:0043138	IBA:GO_Central
ATP binding	GO:0005524	IEA:UniProtKB-KW
four-way junction helicase activity	GO:0009378	IBA:GO_Central
nucleic acid binding	GO:0003676	IEA:InterPro
GO - Biological Process
DNA duplex unwinding	GO:0032508	IBA:GO_Central
DNA recombination	GO:0006310	IBA:GO_Central
DNA repair	GO:0006281	IBA:GO_Central
DNA unwinding involved in DNA replication	GO:0006268	IBA:GO_Central
double-strand break repair via homologous recombination	GO:0000724	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP12919
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     170.91|      52|     193|     346|     408|       2
---------------------------------------------------------------------------
  355-  408 (83.01/82.79)	HMRWSKNKlQVIVGTVAFGMGINKPDVRFVIhHSLSKSMETYYQESGRAGRDGL
  550-  601 (87.90/57.35)	HTAYATNS.YVTVGPRANQVMLGKKIIKMDV.TSTSKDVDGYRKSSKHGVTLGL
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP12919 with Med34 domain of Kingdom Viridiplantae

Unable to open file!