<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12910
| Description |
mediator of RNA polymerase II transcription subunit 15a-like isoform X1 |
| Sequence | MDYRDCEKETCRETTDHDQETLMNGNNLKPTSASEKPAMGRGDWRTQLRSDLRERIIVNKMFDTLKRHLRSSGEDKLNELRKTVEAFEEKTYNAASNQFDYVRRISLKLLQKETQSQNIVQNSGQCSNNLHNPGSQSMQSEQVHGEGLSHQNIPNDMKGKVNIYDLPGKDGPDVIFPKQWPPLPALYISEQTPTIRSTSVDCADLTMAQQNNHSNMHQQQQQQQQLMAQQNNLSNMHQQQLGPQSNISGLQQQQQQLVGTQSGNSSMQTNQQSLHMLSQPKVALQQTQQTAPNLLPTQGQTSQQPQQQQQLMSQMQSQPTQLRQQLGLQQQPNQVQQNMQQRLQASGQTSSSLLQSQNLIDQQQQLYQSQRAVPETSSTSLDSTAQTGHSNGGDWQEEVYQKIKAMKETYFPELNMMHEKISATLLQVEHDSLPQQTKSARLEKMKLFKTMLERILSFLTISRAAIVPAFKDKLSSYEDQIGKFIIANRPRKLVSALQQGQLLPTHMHSMQQPQPESNQTQSHDNQMNPLFPSMMRPAQMPQLKKQMPRLQQLQLLQMLQQRGMHRVDELQSPAKIKTNELSYLHQIDIDSGVLQENLPSNQLPGYEQASSEYHAPDTAGIGVPPIMSIPPLLPGFKEVNDTSGNALTTDFGKPDIAEQPHDLKVNMAKPKSLSATVVTMVDEAVTSVGEDLAAMRKQGLHARNFFTQTGMSGAEKMRCYLSALVILALIIFFIFNLNHQY |
| Length | 741 |
| Position | Tail |
| Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.777 |
| Instability index | 59.74 |
| Isoelectric point | 6.88 |
| Molecular weight | 83734.50 |
| Publications | PubMed=25893780
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12910
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
5| 174.27| 28| 29| 213| 240| 1
---------------------------------------------------------------------------
222- 252 (42.78/14.04) QQQQLMAQQNNLSNMHQQQ.....lgpQ......SN.ISGLQQ
253- 289 (31.20/ 8.26) QQQQLVGTQSGNSSMQTNQ.....qslHmlsqpkVA.LQQTQQ
290- 320 (35.32/10.31) TAPNLLPTQGQTSQQPQQQ.....qqlM......SQ.MQSQPT
362- 397 (30.98/ 8.14) QQQQLYQSQRAVPETSSTSldstaqtgH......SN.GGDWQE
498- 525 (33.98/ 9.64) QQGQLLPTH..MHSMQQPQ.......pE......SNqTQSHDN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 101.28| 28| 31| 603| 630| 2
---------------------------------------------------------------------------
603- 630 (51.74/33.14) LPGYEQASSEYHAPDTAGIGVPPIMSIP
633- 660 (49.54/31.43) LPGFKEVNDTSGNALTTDFGKPDIAEQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 81.81| 19| 19| 536| 554| 3
---------------------------------------------------------------------------
331- 348 (24.65/ 7.60) QPNQVQQNMQQ..RLQaSGQ
536- 554 (34.76/13.58) RPAQMPQLKKQMPRLQ.QLQ
572- 588 (22.40/ 6.27) SPAKIK..TNELSYLH.QID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.49| 18| 20| 115| 132| 4
---------------------------------------------------------------------------
115- 132 (32.86/15.97) QS..QNIVQNSGQCSNNLHN
136- 155 (27.63/12.40) QSmqSEQVHGEGLSHQNIPN
---------------------------------------------------------------------------
|