<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12876
| Description |
mediator of RNA polymerase II transcription subunit 15a-like isoform X1 |
| Sequence | MDTNNWMSTPPSGEPTMDTGDWRTQLLPVSRQRIVNKVMDTLKRHLPFSGQEGLNELRKIAVRFEEKIFTAATSQSDYLKRISLKMLTMENRSQSTVPKTRNKSIPPDPGSQGMQNQVHSQGQPIPISLQSNQSQAQLLPQSVPNNMASAGVQSSAGLQSGMPDVSGLTLNPVPDVVEQHE |
| Length | 181 |
| Position | Tail |
| Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.664 |
| Instability index | 67.17 |
| Isoelectric point | 8.07 |
| Molecular weight | 19933.29 |
| Publications | PubMed=25893780
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12876
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.49| 16| 17| 129| 145| 1
---------------------------------------------------------------------------
112- 127 (28.48/10.07) QGMQNQVHSQGQPIPI
130- 145 (29.02/14.17) QSNQSQAQLLPQSVPN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.98| 10| 16| 27| 36| 3
---------------------------------------------------------------------------
27- 36 (17.96/10.84) LPVSRQRIVN
46- 55 (19.02/11.86) LPFSGQEGLN
---------------------------------------------------------------------------
|