<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12874
| Description |
mediator of RNA polymerase II transcription subunit 9-like isoform X2 |
| Sequence | MTMDTSAGGGSWTTIPSVPPHSNVSTPSNQDPPYLSPPPPPSQQELQQDQHHQSLPSHFHLLHLVENLGDAIDNGTRDQHSDDLINELNNHFEKCQQLLNSIGASINTKPMTVEGQKQKLEESEQLLNQRRDLIANCRSSVEDLVKTEP |
| Length | 149 |
| Position | Middle |
| Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.877 |
| Instability index | 53.66 |
| Isoelectric point | 4.93 |
| Molecular weight | 16546.00 |
| Publications | PubMed=25893780
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12874
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.32| 11| 26| 90| 100| 1
---------------------------------------------------------------------------
90- 100 (21.28/14.03) NHFEKCQQLLN
118- 128 (18.04/10.98) QKLEESEQLLN
---------------------------------------------------------------------------
|