Description | mediator of RNA polymerase II transcription subunit 20a-like isoform X2 |
Sequence | MSKSMHAYEFILTGMSSVLHLLQHSILVEYLPISSLEKSKQIMEEFSDIWKDAISKRSLPGHFIHIEPNFSDYGLADHYTSQHTAVQYTHVTSQLIASVQAVQTGRN |
Length | 107 |
Position | Head |
Organism | Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.162 |
Instability index | 59.71 |
Isoelectric point | 6.20 |
Molecular weight | 12147.64 |
Publications | PubMed=25893780 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP12869 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) IMEEFSDIWK 2) LPGHFIHIEPNFSD | 42 59 | 51 72 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab