<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12831
Description |
mediator of RNA polymerase II transcription subunit 29 |
Sequence | MKVAAQNLVQNSNIDNGQKSNDGLVQRFDKSLEEFYALCDQLELSLRLAYECLSQSFDSAKHSPTLVPTATKPDAVQAESLPYTQYLSMIKAQISCAKDIHNALLECSNKITGKAPAQPGP |
Length | 121 |
Position | Tail |
Organism | Alligator sinensis (Chinese alligator) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Crocodylia> Alligatoridae> Alligatorinae>
Alligator.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.366 |
Instability index | 53.33 |
Isoelectric point | 5.59 |
Molecular weight | 13215.82 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP12831
No repeats found
No repeats found
|