Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MKLALDQGKIHHEMQLLEKVVEKRDSDIQQLQKQLKEAEHILATAVYQAKEKLKSIEKARKGAISSEEIIKYSHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGWLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSSDMSMNMLPPNHSNDFMLEPPGHNKENEDDVEVMSTDSSSSSSDSD |
Length | 191 |
Position | Middle |
Organism | Alligator sinensis (Chinese alligator) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Crocodylia> Alligatoridae> Alligatorinae> Alligator. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.739 |
Instability index | 54.55 |
Isoelectric point | 5.35 |
Molecular weight | 21201.55 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP12828 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 67.52| 18| 33| 90| 107| 1 --------------------------------------------------------------------------- 90- 107 (37.51/23.76) PGDPRRP..YPTDLEMRSGW 124- 143 (30.01/17.73) PGDALAAgrLPDVLAPQYPW --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IIKYSHRI 2) VLAPQY | 69 136 | 76 141 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab